Skip to Content
MilliporeSigma
All Photos(5)

Key Documents

WH0010413M1

Sigma-Aldrich

Monoclonal Anti-YAP1 antibody produced in mouse

clone 2F12, purified immunoglobulin, buffered aqueous solution

Synonym(s):

Anti-YAP, Anti-YAP2, Anti-YAP65, Anti-Yes-associated protein 1, 65kDa

Sign Into View Organizational & Contract Pricing


About This Item

MDL number:
UNSPSC Code:
12352203
NACRES:
NA.41

biological source

mouse

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

2F12, monoclonal

form

buffered aqueous solution

species reactivity

human

technique(s)

ELISA: suitable
immunofluorescence: suitable
immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
western blot: 1-5 μg/mL

isotype

IgG2aκ

GenBank accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... YAP1(10413)

General description

This gene encodes the human ortholog of chicken YAP protein which binds to the SH3 domain of the Yes proto-oncogene product. This protein contains a WW domain that is found in various structural, regulatory and signaling molecules in yeast, nematode, and mammals, and may be involved in protein-protein interaction. (provided by RefSeq)
Yes-associated protein 1 (YAP1) is a transcriptional coactivator. It possesses two WW domains, a TID domain (TEA domain family member 1 transcription factor interacting-domain), sarcoma homology 3 domain (SH3) binding motif, a proline rich region and a PDZ motif. It is expressed in eight isoforms. The YAP1 gene is localized on human chromosome 11q22.1.

Immunogen

YAP1 (NP_006097, 53 a.a. ~ 161 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
QIVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLR

Application

Monoclonal Anti-YAP1 antibody produced in mouse has been used in western blotting and co-immunoprecipitation.

Biochem/physiol Actions

Yes-associated protein 1 (YAP1) promotes cell and tissue growth. It interacts with receptor tyrosine-protein kinase (ErbB4) receptor and regulates transcription. YAP1 is an oncogenic protein and contributes to tumor progression. It is highly expressed in hedgehog-associated medulloblastomas and mutations in YAP1 is also implicated in optic fissure closure defects. Knockdown of YAP1 gene has been shown to lead to apoptosis of prostate cancer cells and is considered as a potential target for treatment.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Amot regulates neuronal dendritic tree through Yap1.
Rojek K, et al.
bioRxiv, 6(1), 345264-345264 (2018)
YAP promotes osteogenesis and suppresses adipogenic differentiation by regulating beta-catenin signaling.
Pan Jin-Xiu, et al.
Bone research, 6(1), 18-18 (2018)
Tumor suppressor Nf2 limits expansion of the neural progenitor pool by inhibiting Yap/Taz transcriptional coactivators.
Lavado A, et al.
Development, 6(1), 096537-096537 (2013)
WW domain-containing protein YAP associates with ErbB-4 and acts as a co-transcriptional activator for the carboxy-terminal fragment of ErbB-4 that translocates to the nucleus.
Komuro A, et al.
The Journal of Biological Chemistry, 22(14), 1962-1971 (2003)
Kai Zhao et al.
The Journal of neuroscience : the official journal of the Society for Neuroscience, 37(13), 3465-3477 (2017-02-19)
Yes-associated protein (Yap) is a major effector of the Hippo pathway that regulates cell proliferation and differentiation during development and restricts tissue growth in adult animals. However, its role in synapse formation remains poorly understood. In this study, we characterized

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service