Skip to Content
Merck
All Photos(6)

Key Documents

HPA009650

Sigma-Aldrich

Anti-ANXA6 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-67 kDa calelectrin antibody produced in rabbit, Anti-Annexin A6 antibody produced in rabbit, Anti-Annexin VI antibody produced in rabbit, Anti-CPB-II antibody produced in rabbit, Anti-Calphobindin-II antibody produced in rabbit, Anti-Chromobindin-20 antibody produced in rabbit, Anti-Lipocortin VI antibody produced in rabbit, Anti-P68 antibody produced in rabbit, Anti-P70 antibody produced in rabbit, Anti-Protein III antibody produced in rabbit

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

rat, mouse, human

enhanced validation

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:200-1:500

immunogen sequence

IADTPSGDKTSLETRFMTILCTRSYPHLRRVFQEFIKMTNYDVEHTIKKEMSGDVRDAFVAIVQSVKNKPLFFADKLYKSMKGAGTDEKTLTRIMVSRSEIDLLNIRREFIEKYDKSLHQAIEGDTSGDFLKALLALCGGED

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... ANXA6(309)

Looking for similar products? Visit Product Comparison Guide

General description

ANXA6 (annexin A6) belongs to a family of structurally highly conserved, Ca2+-regulated membrane-binding proteins called annexins. All annexin proteins are composed of a conserved Ca2+ and phospholipid-binding core and an N-terminal tail, which is different in each annexin. However, unlike other annexins this protein contains eight instead of four annexin repeats.

Immunogen

Annexin A6 recombinant protein epitope signature tag (PrEST)

Application

Anti-ANXA6 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Biochem/physiol Actions

ANXA6 (annexin A6) plays an essential role in maintaining cellular homeostasis of cholesterol. It functions as a negative regulator of influenza A virus (IAV) replication. It therefore, has an antiviral activity attributed to its capability to influence cellular cholesterol pool. It interacts with membrane phospholipdis, F-actin and specific extracellular matrix (ECM) components. Thus, it might be involved in rapid plasma membrane reorganization, which results in cell adhesion and motility. The expression of this protein promotes anchorage-independent cell growth and loss of cell-cell or cell-ECM adhesion. Thus, it facilitates breast cancer tumorigenesis. This protein is thought to be involved in the assembly of detergent-resistant membrane microdomains (DRMs) found in Niemann-Pick type C (NPC) disease, as it is found anchored to the cholesterol storage compartment membranes in NPC disease fibroblasts.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST86509

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Magdalena M Domon et al.
Biochemical and biophysical research communications, 405(2), 192-196 (2011-01-11)
Niemann-Pick type C (NPC) disease is characterized by excessive accumulation of cholesterol in the late endosome/lysosome compartment. Some members of the annexin family of proteins such as annexin A2 (AnxA2) and annexin A6 (AnxA6) follow the same route as cholesterol
Amos M Sakwe et al.
Experimental cell research, 317(6), 823-837 (2010-12-28)
The interaction of annexin A6 (AnxA6) with membrane phospholipids and either specific extracellular matrix (ECM) components or F-actin suggests that it may influence cellular processes associated with rapid plasma membrane reorganization such as cell adhesion and motility. Here, we examined
Agnes Musiol et al.
mBio, 4(6), e00608-e00613 (2013-11-07)
Influenza is caused by influenza A virus (IAV), an enveloped, negative-stranded RNA virus that derives its envelope lipids from the host cell plasma membrane. Here, we examined the functional role of cellular cholesterol in the IAV infection cycle. We show
Hironao Nakayama et al.
Molecular biology of the cell, 23(10), 1964-1975 (2012-03-23)
A disintegrin and metalloproteinase (ADAM) is a family of enzymes involved in ectodomain shedding of various membrane proteins. However, the molecular mechanism underlying substrate recognition by ADAMs remains unknown. In this study, we successfully captured and analyzed cell surface transient
Alex Bayés et al.
PloS one, 7(10), e46683-e46683 (2012-10-17)
Direct comparison of protein components from human and mouse excitatory synapses is important for determining the suitability of mice as models of human brain disease and to understand the evolution of the mammalian brain. The postsynaptic density is a highly

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service