추천 제품
생물학적 소스
mouse
Quality Level
결합
unconjugated
항체 형태
purified immunoglobulin
항체 생산 유형
primary antibodies
클론
CL2720, monoclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
형태
buffered aqueous glycerol solution
종 반응성
human, rat, mouse
향상된 검증
orthogonal RNAseq
Learn more about Antibody Enhanced Validation
기술
immunoblotting: 1 μg/mL
immunohistochemistry: 1:500- 1:1000
동형
IgG1
면역원 서열
LEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE
UniProt 수납 번호
응용 분야
research pathology
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... S100B(6285)
일반 설명
The gene S-100 β subunit (S100B) is a 21kDa acidic protein. It is encoded by the gene mapped to human chromosome 21q22.3. The gene codes for a calcium-binding protein and is a member of S100 family of calcium-binding proteins. The encoded protein is produced predominantly by astrocytes. S100B is a homodimer with two β subunits.
면역원
S100 calcium binding protein B
애플리케이션
All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collecation of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Monoclonal Anti-S100B antibody produced in mouse has been used in immunocytochemistry and immunofluorescence studies.
Monoclonal Anti-S100B antibody produced in mouse has been used in immunocytochemistry and immunofluorescence studies.
생화학적/생리학적 작용
S-100 β subunit (S100B) exerts paracrine and autocrine effects on neurons and glia. At nanomolar concentrations, the encoded protein promotes neurite outgrowth and increases survival of neurons during development. S100B serves as a marker of melanocyte cytotoxicity. In addition, it also acts as a serum marker in endocrine resistant breast cancer and Nonsegmental Vitiligo. Decreased expression of S100B has been observed in chronic liver disease patients.
특징 및 장점
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
물리적 형태
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
법적 정보
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 1
시험 성적서(COA)
제품의 로트/배치 번호를 입력하여 시험 성적서(COA)을 검색하십시오. 로트 및 배치 번호는 제품 라벨에 있는 ‘로트’ 또는 ‘배치’라는 용어 뒤에서 찾을 수 있습니다.
이미 열람한 고객
S100β as a serum marker in endocrine resistant breast cancer.
Charmsaz S, et al.
BMC Medicine, 51(1), 79-79 (2017)
Rapid prenatal diagnosis of trisomy 21 by real-time quantitative polymerase chain reaction with amplification of small tandem repeats and S100B in chromosome 21.
Yang Y H, et al.
Yonsei Medical Journal, 46(6), 193-197 (2005)
Decreased S100B expression in chronic liver diseases.
Baik S J, et al.
The Korean Journal of Internal Medicine, 32(2), 269?276-269?276 (2017)
Yujiao Lu et al.
The Journal of neuroscience : the official journal of the Society for Neuroscience, 40(38), 7355-7374 (2020-08-21)
17β-Estradiol (E2) is produced from androgens via the action of the enzyme aromatase. E2 is known to be made in neurons in the brain, but the functions of neuron-derived E2 in the ischemic brain are unclear. Here, we used a
Ceren Emre et al.
Acta neuropathologica communications, 9(1), 116-116 (2021-07-01)
Sustained brain chronic inflammation in Alzheimer's disease (AD) includes glial cell activation, an increase in cytokines and chemokines, and lipid mediators (LMs), concomitant with decreased pro-homeostatic mediators. The inflammatory response at the onset of pathology engages activation of pro-resolving, pro-homeostatic LMs followed by
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.