추천 제품
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
항체 생산 유형
primary antibodies
클론
polyclonal
형태
buffered aqueous solution
분자량
49 kDa
종 반응성
human
농도
0.5 mg - 1 mg/mL
기술
western blot: suitable
NCBI 수납 번호
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... PIP3-E(26034)
면역원
Synthetic peptide directed towards the middle region of human PIP3-E
애플리케이션
Anti-PIP3-E (AB1) antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/ml.
생화학적/생리학적 작용
PIP3-E (Phosphoinositide-binding protein PIP3-E) also referred to as Interactor protein for cytohesin exchange factors 1 (IPCEF1) is a protein that binds to cytohesin 2 and augments its activity in cultured cells. This results in the nerve injury-induced membrane receptor trafficking in the dorsal root ganglions (DRGs) of adult rats under neuropathic pain conditions. Further, IPCEF1 produces a single protein that plays a crucial role in HGF-induced Arf6 activation and migration in response to HGF treatment.
서열
Synthetic peptide located within the following region: IHKALENSFVTSESGFLNSLSSDDTSSLSSNHDHLTVPDKPAGSKIMDKE
물리적 형태
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
시험 성적서(COA)
제품의 로트/배치 번호를 입력하여 시험 성적서(COA)을 검색하십시오. 로트 및 배치 번호는 제품 라벨에 있는 ‘로트’ 또는 ‘배치’라는 용어 뒤에서 찾을 수 있습니다.
Xiang Zhang et al.
Journal of experimental & clinical cancer research : CR, 39(1), 190-190 (2020-09-18)
Insulin-like growth factor 2 (IGF2) messenger RNA binding protein 3 (IMP3) has been testified to be overexpressed in prostate cancer and strongly related to patients' poor prognosis. However, the functions of IMP3 and the underlying mechanisms in prostate cancer still
Myriam A Attar et al.
Experimental cell research, 318(3), 228-237 (2011-11-17)
Epithelial cells are largely immotile under normal circumstances, but become motile during development, repair of tissue damage and during cancer metastasis. Numerous growth factors act to initiate epithelial cell movements. Hepatocyte growth factor (HGF) induces many epithelial cell lines to
Xiaowei Guan et al.
Naunyn-Schmiedeberg's archives of pharmacology, 380(5), 459-463 (2009-09-17)
Interaction protein for cytohesin exchange factors 1 (IPCEF1) is a recently identified protein that binds to cytohesin 2 and might participate in membrane receptor trafficking by enhancing the activity of cytohesin 2 in cultured cells. However, whether IPCEF1 is involved
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.