HPA008422

Anti-NFKB2 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• 동의어(들): Anti-DNA-binding factor KBF2, Anti-H2TF1, Anti-Lymphocyte translocation chromosome 10, Anti-Lyt10, Anti-Nuclear factor NF-kappa-B p100 subunit, Anti-Oncogene Lyt-10
• MDL number: MFCD01322455
• UNSPSC 코드: 12352203
• 인간 단백질 도해서 번호: HPA008422
• NACRES: NA.43

속성

• 생물학적 소스: rabbit
• 결합: unconjugated
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 제품 라인: Prestige Antibodies^® Powered by Atlas Antibodies
• 형태: buffered aqueous glycerol solution
• 종 반응성: human
• 향상된 검증: orthogonal RNAseq; RNAi knockdown; independent; Learn more about Antibody Enhanced Validation
• 기술: immunoblotting: 0.04-0.4 μg/mL; immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:200-1:500
• 면역원 서열: LLNAAQNTMEPPLTPPSPAGPGLSLGDTALQNLEQLLDGPEAQGSWAELAERLGLRSLVDTYRQTTSPSGSLLRSYELAGGDLAGLLEALSDMGLEEGVRLLRGPETRDKLPSTEVKEDSAYGSQSVEQEA
• UniProt 수납 번호: Q00653
• 응용 분야: research pathology
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... NFKB2(4791)

설명

일반 설명

Nuclear factor NF-κ-B p100 subunit (NFKB2) is a transcription factor which belongs to the NF-kappa B/Rel family of proteins.

면역원

Nuclear factor NF-kappa-B p100 subunit recombinant protein epitope signature tag (PrEST)

애플리케이션

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunohistochemistry (1 paper)

생화학적/생리학적 작용

Nuclear factor NF-κ-B p100 subunit (NFKB2) is at the endpoint of many of signal transduction pathways which are initiated by stimuli such as inflammation, immunity, differentiation, cell growth, tumorigenesis and apoptosis. It forms a homo- or heterodimeric complex with proteins. These complexes bind at κ-B sites in the DNA of their target genes. NFKB2 complexes are present in the cytoplasm in an inactive state bound to the NF-κ-B inhibitors. For the activation of NFKB2, I-κ-B (inhibitor) is phosphorylated by I-κ-B kinases (IKKs) and degraded. Thus the active NF-κ-B complex is free from the inhibitor and can translocate to the nucleus. NFKB2 plays an important role in the cytoplasmic retention of attached NFKB2 proteins by p100 and the generation of p52 by cotranslational processing. It also regulates the circadian clock by repressing the transcriptional activator activity of the complex formed by aryl hydrocarbon receptor nuclear translocator-like protein 1 (ARNTL) with other proteins.

특징 및 장점

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

결합

Corresponding Antigen APREST86729

물리적 형태

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

법적 정보

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable
• 개인 보호 장비: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)