HPA015103

Anti-PTPRZ1 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• 동의어(들): Anti-Protein-tyrosine phosphatase receptor type Z polypeptide 1, Anti-R-PTP-zeta, Anti-Receptor-type tyrosine-protein phosphatase zeta precursor
• UNSPSC 코드: 12352203
• 인간 단백질 도해서 번호: HPA015103
• NACRES: NA.41

속성

• 생물학적 소스: rabbit
• 결합: unconjugated
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 제품 라인: Prestige Antibodies^® Powered by Atlas Antibodies
• 형태: buffered aqueous glycerol solution
• 종 반응성: human
• 향상된 검증: orthogonal RNAseq; Learn more about Antibody Enhanced Validation
• 기술: immunoblotting: 0.04-0.4 μg/mL; immunohistochemistry: 1:500-1:1000
• 면역원 서열: LFRHLHTVSQILPQVTSATESDKVPLHASLPVAGGDLLLEPSLAQYSDVLSTTHAASETLEFGSESGVLYKTLMFSQVEPPSSDAMMHARSSGPEPSYALSDNEGSQHIFTVSYSSAIPVHDSVGVTYQGSLFSGPSHIPIPKSSLIT
• UniProt 수납 번호: P23471
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... PTPRZ1(5803)

설명

일반 설명

PTPRZ1 (protein tyrosine phosphatase, receptor-type, Z polypeptide 1) is a transmembrane protein, which belongs to the receptor-type PTP (RPTP) protein subfamily, the members of which resemble cell adhesion molecules. This protein has three isoforms called PTPRZ-A, PTPRZ-B and phosphacan. The N- termini of all the three isoforms contain a carbonic anhydrase-like (CAH) and a fibronectin type III (FNIII) domain. PTPRZ-A and phosphocan contain a spacer having chondroitin sulfate proteoglycan attachment sites, which is absent in PTPRZ-B. This protein is expressed in multiple tumors, and has a normal expression profile in the central nervous system of mammals.

PTPRZ1 is mapped to human chromosome 7q31.32.

면역원

Receptor-type tyrosine-protein phosphatase zeta precursor recombinant protein epitope signature tag (PrEST)

애플리케이션

Anti-PTPRZ1 antibody produced in rabbit has been used in:

• immunofluorescence
• western blotting
• confocal imaging

Anti-PTPRZ1 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

생화학적/생리학적 작용

PTPRZ1 (protein tyrosine phosphatase, receptor-type, Z polypeptide 1) plays an essential part in the control of cell growth and motility. This protein, especially its isoform PTPRZ-B, is over-expressed in gliomas, and the different domains of PTPRZ-B, differentially control the proliferation and migration of glioma cells. In renal cell carcinoma (RCC) with von Hippel-Lindau (VHL) inactivation, PTPRZ1 enhances the nuclear expression of β-catenin. This promotes the proliferation of VHL-inactive RCC cells. It is under-expressed in head and neck squamous cell carcinoma (HNSCC), which leads to activation of Met protein. Met protein in turn promotes HNSCC metastasis. It acts as an oncogene in small-cell lung carcinoma, where it controls the phosphorylation of calmodulin, and the progression of tumor. It is also up-regulated in human neuroendocrine tumor (NET) cells, and might have potential as a therapeutic target for the same.

특징 및 장점

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

결합

Corresponding Antigen APREST71554

물리적 형태

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

법적 정보

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1
• 개인 보호 장비: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)