HPA029853
Anti-CYR61 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Synonym(s):
Anti-CCN1, Anti-GIG1, Anti-IGFBP10, Anti-cysteine-rich, angiogenic inducer, 61
biological source
rabbit
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
product line
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
technique(s)
immunohistochemistry: 1:20- 1:50
immunogen sequence
CGCCKVCAKQLNEDCSKTQPCDHTKGLECNFGASSTALKGICRAQSEGRPCEYNSRIYQNGESFQPNCKHQCTCIDGAV
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... CYR61(3491)
General description
CYR61 (cysteine-rich angiogenic inducer 61) is an extracellular and heparin-binding protein . It is also known as CCN1 (CCN family member 1) and IGFBP10 (angiogenic factor). It belongs to the CCN group of protein family . It is located on human chromosome 1p22.3. During wound healing, CYR61 is seen in dermal fibroblasts of the granulation tissue.
Immunogen
cysteine-rich, angiogenic inducer, 61 recombinant protein epitope signature tag (PrEST)
Application
All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Anti-CYR61 has been used in immunohistochemistry and immunoblot analysis.
Biochem/physiol Actions
CYR61 (cysteine-rich angiogenic inducer 61) plays a protective role in AKI. It also has an antiapoptotic role in hypoxia induced HK-2 (proximal tubule epithelial cell line ) cells. It participates in several mechanisms, including ECM (extracellular matrix) production and fibrosis. It serves as a factor, that induces angiogenesis and chondrogenesis differentiation. In skin fibroblasts, CYR61 triggers a genetic program for wound healing.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.
Other Notes
Corresponding Antigen APREST76823
Legal Information
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class
10 - Combustible liquids
wgk_germany
WGK 1
flash_point_f
Not applicable
flash_point_c
Not applicable
Choose from one of the most recent versions:
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
The angiogenic factor Cyr61 activates a genetic program for wound healing in human skin fibroblasts
Chen CC, et al.
The Journal of Biological Chemistry, 276(50), 47329-47337 (2001)
Artur Wnorowski et al.
Scientific reports, 12(1), 3618-3618 (2022-03-09)
Metabolic reprogramming contributes to oncogenesis, tumor growth, and treatment resistance in pancreatic ductal adenocarcinoma (PDAC). Here we report the effects of (R,S')-4'-methoxy-1-naphthylfenoterol (MNF), a GPR55 antagonist and biased β2-adrenergic receptor (β2-AR) agonist on cellular signaling implicated in proliferation and metabolism
Expression and function of CYR61, an angiogenic factor, in breast cancer cell lines and tumor biopsies
Tsai MS, et al.
Cancer Research, 60(20), 5603-5607 (2000)
Genome wide gene expression analysis of the posterior capsule in patients with osteoarthritis and knee flexion contracture
Campbell TM, et al.
The Journal of Rheumatology, 41(11), 2232-2239 (2014)
Matrix Metalloproteinase 10 Degradomics in Keratinocytes and Epidermal Tissue Identifies Bioactive Substrates With Pleiotropic Functions
Schlage P, et al.
Molecular and Cellular Proteomics, 14(12), 3234-3246 (2015)
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service