SAB1405145

Monoclonal Anti-P15RS antibody produced in mouse

clone 1B9, purified immunoglobulin, buffered aqueous solution

• Synonym(s): FLJ10656, HsT3101, MGC19513, P15RS
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: mouse
• Quality Level: 100
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 1B9, monoclonal
• form: buffered aqueous solution
• mol wt: antigen ~36.56 kDa
• species reactivity: human
• technique(s): indirect ELISA: suitable; western blot: 1-5 μg/mL
• isotype: IgG2bκ
• NCBI accession no.: NM_018170
• UniProt accession no.: Q96P16
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... RPRD1A(55197)

Description

General description

P15RS is upregulated in cells overexpressing cyclin-dependent kinase inhibitor p15(INK4b) (CDKN2B; MIM 600431) and may have a role in cell cycle regulation (Liu et al., 2002 [PubMed 12470661]).[supplied by OMIM

Immunogen

RPRD1A (NP_060640, 76 a.a. ~ 170 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
EFTKDFAPVIVEAFKHVSSETDESCKKHLGRVLSIWEERSVYENDVLEQLKQALYGDKKPRKRTYEQIKVDENENCSSLGSPSEPPQTLDLVRAL

Physical form

Solution in phosphate buffered saline, pH 7.4

Safety Information

• wgk_germany: WGK 1
• flash_point_f: Not applicable
• flash_point_c: Not applicable