All Photos(3)




Anti-YAP1 antibody produced in rabbit

affinity isolated antibody

Sign Into View Organizational & Contract Pricing

Anti-COB1, Anti-YAP, Anti-YAP-1, Anti-YAP2, Anti-YAP65, Anti-YKI

biological source


Quality Level



antibody form

affinity isolated antibody

antibody product type

primary antibodies




buffered aqueous solution

mol wt


species reactivity

mouse, dog, rabbit, rat, pig, sheep, human, horse, bovine


0.5 mg - 1 mg/mL


immunoblotting: suitable
immunohistochemistry: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.


target post-translational modification


Gene Information

human ... YAP1(10413)

Compare Similar Items

View Full Comparison

Show Differences

1 of 4

This Item
Quality Level


Quality Level


Quality Level


Quality Level


antibody form

affinity isolated antibody

antibody form

affinity isolated antibody

antibody form

affinity isolated antibody

antibody form


biological source


biological source


biological source


biological source



buffered aqueous solution


buffered aqueous glycerol solution


buffered aqueous solution



storage temp.


storage temp.


storage temp.


storage temp.


Still not finding the right product?  

Give our Product Selector Tool a try.


Synthetic peptide directed towards the C terminal region of human YAP1

Biochem/physiol Actions

YAP1 is the human ortholog of chicken YAP protein which binds to the SH3 domain of the Yes proto-oncogene product. YAP1 contains a WW domain that is found in various structural, regulatory and signaling molecules in yeast, nematode, and mammals, and may be involved in protein-protein interaction.


Synthetic peptide located within the following region: QLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDS

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.


Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Storage Class

10 - Combustible liquids




Not applicable


Not applicable

Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Documents related to the products that you have purchased in the past have been gathered in the Document Library for your convenience.

Visit the Document Library

Difficulty Finding Your Product Or Lot/Batch Number?

Product numbers are combined with Pack Sizes/Quantity when displayed on the website (example: T1503-25G). Please make sure you enter ONLY the product number in the Product Number field (example: T1503).


Product Number
Pack Size/Quantity

Additional examples:





enter as 1.000309185)

Having trouble? Feel free to contact Technical Service for assistance.

Lot and Batch Numbers can be found on a product's label following the words 'Lot' or 'Batch'.

Aldrich Products

  • For a lot number such as TO09019TO, enter it as 09019TO (without the first two letters 'TO').

  • For a lot number with a filling-code such as 05427ES-021, enter it as 05427ES (without the filling-code '-021').

  • For a lot number with a filling-code such as STBB0728K9, enter it as STBB0728 without the filling-code 'K9'.

Not Finding What You Are Looking For?

In some cases, a COA may not be available online. If your search was unable to find the COA you can request one.

Request COA

Mark Skamrahl et al.
Advanced science (Weinheim, Baden-Wurttemberg, Germany), 8(19), e2100478-e2100478 (2021-08-13)
Tight junctions (TJs) are essential components of epithelial tissues connecting neighboring cells to provide protective barriers. While their general function to seal compartments is well understood, their role in collective cell migration is largely unexplored. Here, the importance of the

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service