MilliporeSigma
All Photos(8)

Documents

WH0010875M1

Sigma-Aldrich

Monoclonal Anti-FGL2 antibody produced in mouse

clone 6D9, purified immunoglobulin, buffered aqueous solution

Sign Into View Organizational & Contract Pricing

Synonym(s):
Anti-T49, Anti-fibrinogen-like 2, Anti-pT49
NACRES:
NA.41

biological source

mouse

Quality Level

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

6D9, monoclonal

form

buffered aqueous solution

species reactivity

human, mouse, rat

technique(s)

immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
immunoprecipitation (IP): suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

isotype

IgG2aκ

GenBank accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... FGL2(10875)

Compare Similar Items

View Full Comparison

Show Differences

1 of 4

This Item
SAB5300470WH0002274M1AMAB91421
clone

6D9, monoclonal

clone

2H5G2C11, monoclonal

clone

2G3-1A5, monoclonal

clone

CL6491, monoclonal

biological source

mouse

biological source

mouse

biological source

mouse

biological source

-

species reactivity

human, mouse, rat

species reactivity

human

species reactivity

human

species reactivity

human

Gene Information

human ... FGL2(10875)

Gene Information

human ... FGF2(2247)

Gene Information

human ... FHL2(2274)

Gene Information

human ... FGF21(26291)

antibody form

purified immunoglobulin

antibody form

ascites fluid

antibody form

purified immunoglobulin

antibody form

purified immunoglobulin

Still not finding the right product?  

Give our Product Selector Tool a try.

General description

Fibrinogen-like protein 2 (FGL2) belongs to the fibrinogen-like protein family. The FGL2 gene is located on the human chromosome at 7q11.23.

Immunogen

FGL2 (NP_006673, 24 a.a. ~ 123 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
NNETEEIKDERAKDVCPVRLESRGKCEEAGECPYQVSLPPLTIQLPKQFSRIEEVFKEVQNLKEIVNSLKKSCQDCKLQADDNGDPGRNGLLLPSTGAPG

Application

Monoclonal Anti-FGL2 antibody produced in mouse has been used in immunohistochemistry.

Biochem/physiol Actions

Fibrinogen-like protein 2 (FGL2) exhibits prothrombinase activity. It also shows immune regulatory activity during allograft rejection, abortion, and viral infections. This protein acts as an immune coagulant that produces thrombin directly. FGL2 through the clotting-dependent pathway may play a role in tumor angiogenesis and metastasis. It is involved in the pathogenesis of T helper type 1 (Th1) cytokine-induced fetal loss syndrome and viral-induced fulminant hepatitis. FGL2 gene is involved in modulating regulatory T cells (Treg) function. This protein regulates innate and adaptive immunity. FGL2 may serve as a therapeutic agent for glioblastoma (GBM) by promoting GBM progression.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Storage Class

10 - Combustible liquids

flash_point_f

Not applicable

flash_point_c

Not applicable

ppe

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Documents related to the products that you have purchased in the past have been gathered in the Document Library for your convenience.

Visit the Document Library

Difficulty Finding Your Product Or Lot/Batch Number?

Product numbers are combined with Pack Sizes/Quantity when displayed on the website (example: T1503-25G). Please make sure you enter ONLY the product number in the Product Number field (example: T1503).

Example:

T1503
Product Number
-
25G
Pack Size/Quantity

Additional examples:

705578-5MG-PW

PL860-CGA/SHF-1EA

MMYOMAG-74K-13

1000309185

enter as 1.000309185)

Having trouble? Feel free to contact Technical Service for assistance.

Lot and Batch Numbers can be found on a product's label following the words 'Lot' or 'Batch'.

Aldrich Products

  • For a lot number such as TO09019TO, enter it as 09019TO (without the first two letters 'TO').

  • For a lot number with a filling-code such as 05427ES-021, enter it as 05427ES (without the filling-code '-021').

  • For a lot number with a filling-code such as STBB0728K9, enter it as STBB0728 without the filling-code 'K9'.

Not Finding What You Are Looking For?

In some cases, a COA may not be available online. If your search was unable to find the COA you can request one.

Request COA

Kai Su et al.
World journal of gastroenterology, 14(39), 5980-5989 (2008-10-22)
To examine the role of Fibrinogen-like protein 2 (fgl2)/fibroleukin in tumor development. Fgl2 has been reported to play a vital role in the pathogenesis in MHV-3 (mouse hepatitis virus) induced fulminant and severe hepatitis, spontaneous abortion, allo- and xeno- graft
Camie W Y Chan et al.
Journal of immunology (Baltimore, Md. : 1950), 170(8), 4036-4044 (2003-04-12)
Fibrinogen-like protein 2 (fgl2)/fibroleukin is a member of the fibrinogen-related protein superfamily. In addition to its established role in triggering thrombosis, it is known to be secreted by T cells. The soluble fgl2 ((s)fgl2) protein generated in a baculovirus expression
Liang Shao et al.
Fundamental & clinical pharmacology, 28(1), 42-52 (2012-09-19)
Atorvastatin is not only an antilipemic but also used as an anti-inflammatory medicine in heart disease. Our working hypothesis was that atorvastatin preconditioning could improve the forward blood flow in the no-reflow rats associated with inflammation. We investigated that two
Yu Ding et al.
Chinese journal of integrative medicine, 27(7), 527-533 (2020-01-07)
To investigate the protective effects of Shexiang Tongxin Dropping Pill (, STDP) following sodium laurate-induced coronary microembolization (CME) in rats. Forty rats were divided into 4 groups: the control (sham) group, CME group, low-dose STDP pretreatment group (20 mg·kg-1·d-1), and
Liang Shao et al.
Clinical and applied thrombosis/hemostasis : official journal of the International Academy of Clinical and Applied Thrombosis/Hemostasis, 19(1), 19-28 (2012-03-06)
No-reflow phenomenon due to cardiac microvascular dysfunction or disturbance aggravates clinic outcomes of a portion of patients with acute myocardial infarction undergoing percutaneous coronary intervention or thrombolytic therapy. Our working hypothesis was that cardiac microthrombosis would play an important role

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service