MilliporeSigma
Search Within
Shipping
Product Category
Brand
Color
Feature
Formula Weight
Gene Alias
Melting Point (°C)
Physical Form
Product Line
Purity
Agency
Chemical Composition
Quality Segment
Application
Markush Class
Markush Group
Optical Isomer
Amino Acid
Special Grade
Technique
Available for Sale

200-291-6

Applied Filters:
Keyword:'200-291-6'
Showing 1-25 of 25 results for "200-291-6" within Products
All Photos(2)

4′-Nitrocinnamic acid

Synonym(s): 4′-Nitrocinnamic acid
Linear Formula: 4-(NO2)C6H4CH=CHCOOH
CAS No.:
882-06-4
Molecular Weight:
193.16
CompareProduct No.DescriptionSDSPricing
8.18563for synthesis
All Photos(1)

DL-2-Aminobutyric acid

Linear Formula: C2H5CH(NH2)CO2H
CAS No.:
2835-81-6
Molecular Weight:
103.12
EC No.:
220-616-5
Beilstein No.:
635889
CompareProduct No.DescriptionSDSPricing
162663ReagentPlus®, 99%
All Photos(1)

D-Alanine-1-13C

Linear Formula: CH3CH(NH2)13CO2H
Molecular Weight:
90.09
CompareProduct No.DescriptionSDSPricing
60462399 atom % 13C
All Photos(1)

D-Alanine-13C3

Linear Formula: 13CH313CH(NH2)13CO2H
CAS No.:
286460-72-8
Molecular Weight:
92.07
CompareProduct No.DescriptionSDSPricing
49211699 atom % 13C
All Photos(1)

D-allo-Isoleucine

Synonym(s): (2R,3S)-2-Amino-3-methylpentanoic acid
Linear Formula: CH3CH2CH(CH3)CH(NH2)CO2H
CAS No.:
1509-35-9
Molecular Weight:
131.17
EC No.:
216-143-9
Beilstein No.:
1721794
CompareProduct No.DescriptionSDSPricing
I0380
All Photos(1)

trans-Azobenzene

Synonym(s): trans-Azobenzene
Linear Formula: C6H5N=NC6H5
CAS No.:
103-33-3
Molecular Weight:
182.22
CompareProduct No.DescriptionSDSPricing
8.20118for synthesis
All Photos(4)

D-Alanine

Synonym(s): (R)-2-Aminopropionic acid
Linear Formula: CH3CH(NH2)CO2H
CAS No.:
338-69-2
Molecular Weight:
89.09
EC No.:
206-418-1
Beilstein No.:
1720249
CompareProduct No.DescriptionSDSPricing
A7377≥98% (HPLC)
All Photos(1)

3,5-Pyrocatecholdisulfonic acid disodium salt monohydrate

Synonym(s): 3,5-Pyrocatecholdisulfonic acid disodium salt monohydrate
Empirical Formula (Hill Notation): C6H4Na2O8S2 · xH2O
CAS No.:
149-45-1
Molecular Weight:
314.20 (anhydrous basis)
CompareProduct No.DescriptionSDSPricing
1.01922(Tiron) metal indicator
All Photos(1)

D-Alanine-15N

Linear Formula: CH3CH(15NH2)CO2H
Molecular Weight:
90.09
CompareProduct No.DescriptionSDSPricing
61852798 atom % 15N
All Photos(3)

Azure A chloride

Empirical Formula (Hill Notation): C14H14ClN3S
CAS No.:
531-53-3
Molecular Weight:
291.80
EC No.:
208-510-7
Beilstein No.:
3922287
All Photos(3)

Basic Fuchsin

Synonym(s): Basic Parafuchsin, Basic Red 9, Magenta O, Parafuchsin hydrochloride, Paramagenta hydrochloride, Pararosaniline chloride, Pararosaniline hydrochloride
Empirical Formula (Hill Notation): C19H17N3 · HCl
CAS No.:
569-61-9
Molecular Weight:
323.82
EC No.:
209-321-2
Beilstein No.:
4164603
All Photos(2)

1,9-Dimethyl-Methylene Blue zinc chloride double salt

Synonym(s): DMMB, Taylor’s Blue
Empirical Formula (Hill Notation): C18H22ClN3S · 0.5ZnCl2
CAS No.:
931418-92-7
Molecular Weight:
416.05
CompareProduct No.DescriptionSDSPricing
341088Dye content 80 %
All Photos(10)

Synonym(s): (S)-(+)-Aminosuccinic acid, (S)-Aminobutanedioic acid
Linear Formula: HO2CCH2CH(NH2)CO2H
CAS No.:
56-84-8
Molecular Weight:
133.10
EC No.:
200-291-6
Beilstein No.:
1723530
All Photos(1)

Synonym(s): (S)-(+)-Aminosuccinic acid, (S)-Aminobutanedioic acid
Linear Formula: HO2CCH2CH(NH2)CO2H
CAS No.:
56-84-8
Molecular Weight:
133.10
EC No.:
200-291-6
Beilstein No.:
1723530
All Photos(1)

L-Aspartic acid

Synonym(s): (S)-(+)-Aminosuccinic acid, (S)-Aminobutanedioic acid
Linear Formula: HO2CCH2CH(NH2)CO2H
CAS No.:
56-84-8
Molecular Weight:
133.10
EC No.:
200-291-6
Beilstein No.:
1723530
CompareProduct No.DescriptionSDSPricing
11189BioUltra, ≥99.5% (T)
All Photos(1)

Exendin-4

Empirical Formula (Hill Notation): C184H282N50O60S
CAS No.:
141758-74-9
Molecular Weight:
4186.57
CompareProduct No.DescriptionSDSPricing
E7144≥97%
All Photos(1)

Synonym(s): NPY, hNPY, Neuropeptide Y, Human
Empirical Formula (Hill Notation): C189H285N55O57S
CAS No.:
90880-35-6
Molecular Weight:
4271.68
All Photos(1)

Adrenocorticotropic Hormone human

Synonym(s): Adrenocorticotropic hormone fragment 1-39, Corticotropin A
Empirical Formula (Hill Notation): C207H308N56O58S
CAS No.:
12279-41-3
Molecular Weight:
4541.07
CompareProduct No.DescriptionSDSPricing
A0423≥97% (HPLC)
All Photos(1)

Charybdotoxin

Empirical Formula (Hill Notation): C176H277N57O55S7
CAS No.:
95751-30-7
Molecular Weight:
4295.89
CompareProduct No.DescriptionSDSPricing
C7802≥90% (HPLC)
All Photos(1)

Glucagon-Like Peptide I human

Synonym(s): GLP-1, Preproglucagon 72-108
Empirical Formula (Hill Notation): C186H275N51O59
CAS No.:
87805-34-3
Molecular Weight:
4169.48
CompareProduct No.DescriptionSDSPricing
G3265≥97% (HPLC)
All Photos(1)

Iberiotoxin, Buthus tamulus, Recombinant, E. coli

Synonym(s): Iberiotoxin, Buthus tamulus, Recombinant, E. coli
CAS No.:
129203-60-7
CompareProduct No.DescriptionSDSPricing
401002
All Photos(1)

SNX-482

Synonym(s): SNX-482
Empirical Formula (Hill Notation): C192H274N52O60S7
CAS No.:
203460-30-4
Molecular Weight:
4495.00
CompareProduct No.DescriptionSDSPricing
5.08512
All Photos(1)

Exenatide

Synonym(s): Exendin-4
Empirical Formula (Hill Notation): C184H282N50O60S
CAS No.:
141758-74-9
Molecular Weight:
4186.57
CompareProduct No.DescriptionPricing
1269105United States Pharmacopeia (USP) Reference Standard
All Photos(1)

SNX-482 Recombinant

Synonym(s): GVDKAGCRYMFGGCSVNDDCCPRLGCHSLFSYCAWDLTFSD
Empirical Formula (Hill Notation): C192H274N52O60S7
CAS No.:
203460-30-4
Molecular Weight:
4495.00
CompareProduct No.DescriptionSDSPricing
SML1150≥98% (HPLC)
All Photos(1)

bis-MPA-Acetylene dendrimer

Empirical Formula (Hill Notation): C279H326O138
Molecular Weight:
5887.49
CompareProduct No.DescriptionSDSPricing
806153trimethylol propane core, generation 3
Page 1 of 1