MilliporeSigma
Search Within
Shipping
Product Category
Brand
Biological Source
Color
Formula Weight
Gene Alias
Manufacturer
Physical Form
Purity
Activity Spectrum
Agency
Format
Quality Segment
Application
API Family
Reference Material Type
Special Grade
Sterility
Technique
Available for Sale

202-235-6

Applied Filters:
Keyword:'202-235-6'
Showing 1-30 of 47 results for "202-235-6" within Products
All Photos(1)

Eugenyl acetate

Synonym(s): 4-Allyl-2-methoxyphenyl acetate, O-Acetyleugenol, Eugenol acetate
Empirical Formula (Hill Notation): C12H14O3
CAS No.:
93-28-7
Molecular Weight:
206.24
EC No.:
202-235-6
CompareProduct No.DescriptionSDSPricing
W246905≥98%, FCC, FG
All Photos(1)

Acetyleugenol

Synonym(s): Eugenyl acetate, 4-Allyl-2-methoxyphenyl acetate, O-Acetyleugenol, Eugenol acetate
Empirical Formula (Hill Notation): C12H14O3
CAS No.:
93-28-7
Molecular Weight:
206.24
EC No.:
202-235-6
CompareProduct No.DescriptionSDSPricing
04733analytical standard
All Photos(1)

Empirical Formula (Hill Notation): C157H232N40O47S2
CAS No.:
30003-72-6
Molecular Weight:
3495.89
All Photos(1)

Glucagon, Human

Synonym(s): Glucagon, Human
Empirical Formula (Hill Notation): C153H225N43O49S
CAS No.:
9007-92-5
Molecular Weight:
3482.75
All Photos(1)

ProteoMass Insulin chain B oxidized MALDI-MS Standard

Synonym(s): Insulin Chain B Oxidized from bovine pancreas
Empirical Formula (Hill Notation): C157H232N40O47S2
CAS No.:
30003-72-6
Molecular Weight:
3495.89
CompareProduct No.DescriptionSDSPricing
I6154vial of 10 nmol
All Photos(1)

Proinsulin C-Peptide (55-89) human

Synonym(s): Proinsulin connecting peptide
Empirical Formula (Hill Notation): C153H259N49O52
CAS No.:
11097-48-6
Molecular Weight:
3616.99
CompareProduct No.DescriptionSDSPricing
C4999bioactive peptide hormone
All Photos(1)

Astressin

Synonym(s): [D-Phe12, Nle21,38, Glu30, Lys33]-Corticotropin Releasing Factor fragment 12-41
Empirical Formula (Hill Notation): C161H269N49O42
CAS No.:
170809-51-5
Molecular Weight:
3563.16
CompareProduct No.DescriptionSDSPricing
A4933≥90% (HPLC)
All Photos(1)

Human glucagon

Synonym(s): Glucagon
Empirical Formula (Hill Notation): C153H225N43O49S
CAS No.:
9007-92-5
Molecular Weight:
3482.75
CompareProduct No.DescriptionPricing
Y0000191European Pharmacopoeia (EP) Reference Standard
All Photos(1)

Diabetes Associated Peptide Amide human

Synonym(s): Amylin, DAP, IAPP, Insulinoma or Islet amyloid polypeptide
Empirical Formula (Hill Notation): C165H261N51O55S2
CAS No.:
122384-88-7
Molecular Weight:
3903.28
CompareProduct No.DescriptionSDSPricing
D2162≥97% (HPLC)
All Photos(1)

Margatoxin

Synonym(s): MgTx
Empirical Formula (Hill Notation): C178H286N52O50S7
CAS No.:
145808-47-5
Molecular Weight:
4178.95
CompareProduct No.DescriptionSDSPricing
M8278
All Photos(1)

Cecropin B

Empirical Formula (Hill Notation): C176H301N51O42S
CAS No.:
80451-05-4
Molecular Weight:
3835.65
CompareProduct No.DescriptionSDSPricing
C1796≥97% (HPLC), powder
All Photos(1)

Iberiotoxin, Buthus tamulus, Recombinant, E. coli

Synonym(s): Iberiotoxin, Buthus tamulus, Recombinant, E. coli
CAS No.:
129203-60-7
CompareProduct No.DescriptionSDSPricing
401002
All Photos(1)

SNX-482

Synonym(s): SNX-482
Empirical Formula (Hill Notation): C192H274N52O60S7
CAS No.:
203460-30-4
Molecular Weight:
4495.00
CompareProduct No.DescriptionSDSPricing
5.08512
All Photos(1)

Exendin Fragment 9-39

Empirical Formula (Hill Notation): C149H234N40O47S
CAS No.:
133514-43-9
Molecular Weight:
3369.76
CompareProduct No.DescriptionSDSPricing
E7269≥95% (HPLC)
All Photos(1)

Exendin-4

Empirical Formula (Hill Notation): C184H282N50O60S
CAS No.:
141758-74-9
Molecular Weight:
4186.57
CompareProduct No.DescriptionSDSPricing
E7144≥97%
All Photos(1)

Calcitonin Gene Related Peptide human

Synonym(s): α-CGRP, CGRP-I
Empirical Formula (Hill Notation): C163H267N51O49S2
CAS No.:
90954-53-3
Molecular Weight:
3789.31
CompareProduct No.DescriptionSDSPricing
C0167≥95% (HPLC), powder
All Photos(1)

Cecropin A

Empirical Formula (Hill Notation): C184H313N53O46
CAS No.:
80451-04-3
Molecular Weight:
4003.78
CompareProduct No.DescriptionSDSPricing
C6830≥97% (HPLC), powder
All Photos(1)

Chlorotoxin from Leiurus quinquestriatus (north Africa)

Empirical Formula (Hill Notation): C158H256N52O48S11
CAS No.:
163515-35-3
Molecular Weight:
4004.76
All Photos(1)

Synonym(s): Parathyroid Hormone Fragment 1-34 human, PTH 1-34, Parathormone (1-34)
Empirical Formula (Hill Notation): C181H291N55O51S2
CAS No.:
52232-67-4
Molecular Weight:
4117.72
All Photos(1)

Pramlintide acetate salt

Synonym(s): 25,28,29 TriPro-amylin (human) acetate, AC 0137, AC 137, AC0137, AC137, TriPro-amylin acetate, [Pro25,28,29]-amylin (human) acetate
Empirical Formula (Hill Notation): C171H267N51O53S2
CAS No.:
187887-46-3
Molecular Weight:
3949.39
CompareProduct No.DescriptionSDSPricing
SML2523≥95% (HPLC)
All Photos(1)

Calcitonin Gene-Related Peptide-I, Human

Synonym(s): Calcitonin Gene-Related Peptide-I, Human
Empirical Formula (Hill Notation): C163H267N51O49S2
CAS No.:
90954-53-3
Molecular Weight:
3789.31
All Photos(1)

Exenatide

Synonym(s): Exendin-4
Empirical Formula (Hill Notation): C184H282N50O60S
CAS No.:
141758-74-9
Molecular Weight:
4186.57
CompareProduct No.DescriptionPricing
1269105United States Pharmacopeia (USP) Reference Standard
All Photos(1)

Orexin A human, rat, mouse

Empirical Formula (Hill Notation): C152H243N47O44S4
CAS No.:
205599-75-3
Molecular Weight:
3561.10
CompareProduct No.DescriptionSDSPricing
O6012≥97% (HPLC)
All Photos(1)

Teriparatide for system suitability

Synonym(s): Parathyroid Hormone Fragment 1-34 human, PTH 1-34, Parathormone (1-34)
Empirical Formula (Hill Notation): C181H291N55O51S2
CAS No.:
52232-67-4
Molecular Weight:
4117.72
CompareProduct No.DescriptionSDSPricing
Y0001895European Pharmacopoeia (EP) Reference Standard
All Photos(1)

Parathyroid Hormone Fragment 1-34 bovine

Empirical Formula (Hill Notation): C183H288N54O50S2
CAS No.:
12583-68-5
Molecular Weight:
4108.71
CompareProduct No.DescriptionSDSPricing
P3671≥97% (HPLC), powder
All Photos(1)

SNX-482 Recombinant

Synonym(s): GVDKAGCRYMFGGCSVNDDCCPRLGCHSLFSYCAWDLTFSD
Empirical Formula (Hill Notation): C192H274N52O60S7
CAS No.:
203460-30-4
Molecular Weight:
4495.00
CompareProduct No.DescriptionSDSPricing
SML1150≥98% (HPLC)
All Photos(1)

Parathyroid Hormone 1-34, Human

Synonym(s): Parathyroid Hormone 1-34, Human
Empirical Formula (Hill Notation): C181H291N55O51S2
CAS No.:
52232-67-4
Molecular Weight:
4117.72
All Photos(1)

Synonym(s): NPY, hNPY, Neuropeptide Y, Human
Empirical Formula (Hill Notation): C189H285N55O57S
CAS No.:
90880-35-6
Molecular Weight:
4271.68
All Photos(1)

Adrenocorticotropic Hormone human

Synonym(s): Adrenocorticotropic hormone fragment 1-39, Corticotropin A
Empirical Formula (Hill Notation): C207H308N56O58S
CAS No.:
12279-41-3
Molecular Weight:
4541.07
CompareProduct No.DescriptionSDSPricing
A0423≥97% (HPLC)
Page 1 of 2