MilliporeSigma
Search Within
Shipping
Product Category
Brand
Biological Source
Color
Feature
Formula Weight
Gene Alias
Manufacturer
Physical Form
Purity
Activity Spectrum
Format
Quality Segment
Application
Reference Material Type
Special Grade
Technique
Available for Sale

209-180-7

Applied Filters:
Keyword:'209-180-7'
Showing 1-30 of 68 results for "209-180-7" within Products
All Photos(1)

PCB standard solution 7

CompareProduct No.DescriptionSDSPricing
36989analytical standard, 10 μg/mL in isooctane
All Photos(1)

Corticotropin Releasing Factor Fragment 6-33 human, rat

Empirical Formula (Hill Notation): C141H231N41O43S
CAS No.:
120066-38-8
Molecular Weight:
3220.66
CompareProduct No.DescriptionSDSPricing
C0961≥97% (HPLC)
All Photos(1)

Parathyroid Hormone Fragment 1-34 bovine

Empirical Formula (Hill Notation): C183H288N54O50S2
CAS No.:
12583-68-5
Molecular Weight:
4108.71
CompareProduct No.DescriptionSDSPricing
P3671≥97% (HPLC), powder
All Photos(1)

C-Peptide solution

Empirical Formula (Hill Notation): C129H211N35O48
CAS No.:
33017-11-7
Molecular Weight:
3020.26
All Photos(1)

Cecropin P1 Porcine

Empirical Formula (Hill Notation): C147H253N45O43
CAS No.:
125667-96-1
Molecular Weight:
3338.86
CompareProduct No.DescriptionSDSPricing
C7927≥95% (HPLC), powder
All Photos(5)

Lignoceric acid

Synonym(s): Tetracosanoic acid
Linear Formula: CH3(CH2)22COOH
CAS No.:
557-59-5
Molecular Weight:
368.64
EC No.:
209-180-7
Beilstein No.:
1728237
CompareProduct No.DescriptionSDSPricing
L6641≥99% (GC)
All Photos(1)

Defensin HNP-1 human

Synonym(s): Neutrophil Peptide-1
Empirical Formula (Hill Notation): C150H222N44O38S6
CAS No.:
99287-08-8
Molecular Weight:
3442.03
CompareProduct No.DescriptionSDSPricing
D2043≥80% (HPLC)
All Photos(1)

Glucagon-Like Peptide I Amide Fragment 7-36 human

Synonym(s): Preproglucagon 78-107 Amide
Empirical Formula (Hill Notation): C149H226N40O45
CAS No.:
107444-51-9
Molecular Weight:
3297.63
CompareProduct No.DescriptionSDSPricing
G8147≥97% (HPLC), powder
All Photos(1)

Parathyroid Hormone 1-34, Human

Synonym(s): Parathyroid Hormone 1-34, Human
Empirical Formula (Hill Notation): C181H291N55O51S2
CAS No.:
52232-67-4
Molecular Weight:
4117.72
All Photos(1)

SNX-482 Recombinant

Synonym(s): GVDKAGCRYMFGGCSVNDDCCPRLGCHSLFSYCAWDLTFSD
Empirical Formula (Hill Notation): C192H274N52O60S7
CAS No.:
203460-30-4
Molecular Weight:
4495.00
CompareProduct No.DescriptionSDSPricing
SML1150≥98% (HPLC)
All Photos(1)

SNX-482

Synonym(s): SNX-482
Empirical Formula (Hill Notation): C192H274N52O60S7
CAS No.:
203460-30-4
Molecular Weight:
4495.00
CompareProduct No.DescriptionSDSPricing
5.08512
All Photos(1)

Vasoactive Intestinal Peptide, Human, Porcine, and Rat

Synonym(s): Vasoactive Intestinal Peptide, Human, Porcine, and Rat
Empirical Formula (Hill Notation): C147H238N44O42S
CAS No.:
40077-57-4
Molecular Weight:
3325.80
All Photos(1)

Exendin-4

Empirical Formula (Hill Notation): C184H282N50O60S
CAS No.:
141758-74-9
Molecular Weight:
4186.57
CompareProduct No.DescriptionSDSPricing
E7144≥97%
All Photos(1)

Glucagon-Like Peptide 1 Fragment 7-37 human

Synonym(s): GLP-1, 7-37, Preproglucagon 78-108
Empirical Formula (Hill Notation): C151H228N40O47
Molecular Weight:
3355.67
CompareProduct No.DescriptionSDSPricing
G9416≥96% (HPLC)
All Photos(1)

Glucagon-Like Peptide I human

Synonym(s): GLP-1, Preproglucagon 72-108
Empirical Formula (Hill Notation): C186H275N51O59
CAS No.:
87805-34-3
Molecular Weight:
4169.48
CompareProduct No.DescriptionSDSPricing
G3265≥97% (HPLC)
All Photos(1)

Thymosin α1 bovine

Synonym(s): Ac-Ser-Asp-Ala-Ala-Val-Asp-Thr-Ser-Ser-Glu-Ile-Thr-Thr-Lys-Asp-Leu-Lys-Glu-Lys-Lys-Glu-Val-Val-Glu-Glu-Ala-Glu-Asn
Empirical Formula (Hill Notation): C129H215N33O55
CAS No.:
62304-98-7
Molecular Weight:
3108.28
CompareProduct No.DescriptionSDSPricing
T3410≥90% (HPLC)
All Photos(1)

GO-201 trifluoroacetate salt

Synonym(s): D-Arg-D-Arg- D-Arg- D-Arg- D-Arg- D-Arg- D-Arg- D-Arg- D-Arg-Cys-Gln-Cys-Arg-Arg-Lys-Asn-Tyr-Gly-Gln-Leu-Asp-Ile-Phe-Pro trifluoroacetate
Empirical Formula (Hill Notation): C133H233N61O31S2 · xC2HF3O2
Molecular Weight:
3246.79 (free base basis)
CompareProduct No.DescriptionSDSPricing
G7923≥95% (HPLC)
All Photos(1)

PACAP 27 Amide, Ovine

Synonym(s): PACAP 27 Amide, Ovine
Empirical Formula (Hill Notation): C142H224N40O39S
CAS No.:
127317-03-7
Molecular Weight:
3147.61
All Photos(3)

PAMAM dendrimer, ethylenediamine core, generation 2.0 solution

Linear Formula: [NH2(CH2)2NH2]:(G=2);dendri PAMAM(NH2)16
CAS No.:
93376-66-0
Molecular Weight:
3256.18
CompareProduct No.DescriptionSDSPricing
41240620 wt. % in methanol
All Photos(1)

ProteoMass Insulin chain B oxidized MALDI-MS Standard

Synonym(s): Insulin Chain B Oxidized from bovine pancreas
Empirical Formula (Hill Notation): C157H232N40O47S2
CAS No.:
30003-72-6
Molecular Weight:
3495.89
CompareProduct No.DescriptionSDSPricing
I6154vial of 10 nmol
All Photos(1)

Secretin human

Empirical Formula (Hill Notation): C130H220N44O40
CAS No.:
108153-74-8
Molecular Weight:
3039.41
CompareProduct No.DescriptionSDSPricing
S7147≥97% (HPLC), powder
All Photos(1)

Lactoferrin (from bovine milk)

CAS No.:
146897-68-9
CompareProduct No.DescriptionSDSPricing
L-047certified reference material, pkg of 50 mg, Cerilliant®
All Photos(1)

Glucagon, Human

Synonym(s): Glucagon, Human
Empirical Formula (Hill Notation): C153H225N43O49S
CAS No.:
9007-92-5
Molecular Weight:
3482.75
All Photos(1)

Synonym(s): Neuropeptide Y, Human, NPY, hNPY
Empirical Formula (Hill Notation): C189H285N55O57S
CAS No.:
90880-35-6
Molecular Weight:
4271.68
CompareProduct No.DescriptionSDSPricing
05-23-2005A potent vasoconstrictor.
N5017≥95% (HPLC), powder, synthetic
All Photos(1)

Exendin Fragment 9-39

Empirical Formula (Hill Notation): C149H234N40O47S
CAS No.:
133514-43-9
Molecular Weight:
3369.76
CompareProduct No.DescriptionSDSPricing
E7269≥95% (HPLC)
All Photos(1)

Atrial Natriuretic Peptide human

Synonym(s): ANF 1-28, hANF
Empirical Formula (Hill Notation): C127H203N45O39S3
CAS No.:
91917-63-4
Molecular Weight:
3080.44
CompareProduct No.DescriptionSDSPricing
A1663≥97% (HPLC)
All Photos(1)

Chlorotoxin from Leiurus quinquestriatus (north Africa)

Empirical Formula (Hill Notation): C158H256N52O48S11
CAS No.:
163515-35-3
Molecular Weight:
4004.76
CompareProduct No.DescriptionSDSPricing
C5238recombinant, expressed in E. coli, ≥98% (HPLC), lyophilized powder
All Photos(1)

Adrenocorticotropic Hormone human

Synonym(s): Adrenocorticotropic hormone fragment 1-39, Corticotropin A
Empirical Formula (Hill Notation): C207H308N56O58S
CAS No.:
12279-41-3
Molecular Weight:
4541.07
CompareProduct No.DescriptionSDSPricing
A0423≥97% (HPLC)
All Photos(1)

Iberiotoxin, Buthus tamulus, Recombinant, E. coli

Synonym(s): Iberiotoxin, Buthus tamulus, Recombinant, E. coli
CAS No.:
129203-60-7
CompareProduct No.DescriptionSDSPricing
401002
All Photos(1)

Teriparatide for system suitability

Synonym(s): Parathyroid Hormone Fragment 1-34 human, PTH 1-34, Parathormone (1-34)
Empirical Formula (Hill Notation): C181H291N55O51S2
CAS No.:
52232-67-4
Molecular Weight:
4117.72
CompareProduct No.DescriptionSDSPricing
Y0001895European Pharmacopoeia (EP) Reference Standard
Page 1 of 3