210-219-5

Applied Filters:

Keyword:'210-219-5'

Showing 1-30 of 70 results for "210-219-5" within Products

All Photos(7)

Synonym(s): Insulin human

Empirical Formula (Hill Notation): C₂₅₇H₃₈₃N₆₅O₇₇S₆

CAS No.:: 11061-68-0
Molecular Weight:: 5807.57

Compare	Product No.	Description	SDS	Pricing
	I0908	meets USP testing specifications
	I2643	recombinant, expressed in yeast (proprietary host)
	11376497001	recombinant (yeast)
	I3536	recombinant, expressed in yeast, γ-irradiated, suitable for cell culture
	1342106	United States Pharmacopeia (USP) Reference Standard

All Photos(13)

Empirical Formula (Hill Notation): C₂₅₄H₃₇₇N₆₅O₇₅S₆

CAS No.:: 11070-73-8
Molecular Weight:: 5733.49
EC No.:: 234-291-2

Compare	Product No.	Description		SDS	Pricing
	I5500	≥25 USP units/mg (HPLC), powder
	I6634	powder, BioReagent, suitable for cell culture
	I1882	γ-irradiated, BioXtra, suitable for cell culture, potency: ≥20 units/mg (USP units), lyophilized powder
	I4011	Hybri-Max^™, powder, suitable for hybridoma

All Photos(1)

Adrenocorticotropic Hormone human

Synonym(s): Adrenocorticotropic hormone fragment 1-39, Corticotropin A

Empirical Formula (Hill Notation): C₂₀₇H₃₀₈N₅₆O₅₈S

CAS No.:: 12279-41-3
Molecular Weight:: 4541.07

Compare	Product No.	Description	SDS	Pricing
	A0423	≥97% (HPLC)

All Photos(1)

Gastric Inhibitory Polypeptide human

Synonym(s): GIP, Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln

Empirical Formula (Hill Notation): C₂₂₆H₃₃₈N₆₀O₆₆S

CAS No.:: 100040-31-1
Molecular Weight:: 4983.53

Compare	Product No.	Description	SDS	Pricing
	G2269	≥95% (HPLC), suitable for ligand binding assays

All Photos(1)

ProteoMass^™ Insulin MALDI-MS Standard

Synonym(s): Insulin from bovine pancreas

Empirical Formula (Hill Notation): C₂₅₄H₃₇₇N₆₅O₇₅S₆

CAS No.:: 11070-73-8
Molecular Weight:: 5733.49
EC No.:: 234-291-2

Compare	Product No.	Description	SDS	Pricing
	I6279	vial of 10 nmol, monoisotopic mol wt 5,729.6087 Da

All Photos(2)

Insulin from porcine pancreas

Synonym(s): Insulin from hog pancreas

Empirical Formula (Hill Notation): C₂₅₆H₃₈₁N₆₅O₇₆S₆

CAS No.:: 12584-58-6
Molecular Weight:: 5777.54
EC No.:: 235-703-3

Compare	Product No.	Description	SDS	Pricing
	I5523	powder, ≥27 USP units/mg

All Photos(1)

Insulin, Human Recombinant

Synonym(s): Insulin sodium salt human

CAS No.:: 11061-68-0
EC No.:: 234-279-7

Compare	Product No.	Description	SDS	Pricing
	91077C	dry powder, for research or for further manufacturing use

All Photos(1)

Insulin (bovine)

Synonym(s): Insulin from bovine pancreas

Empirical Formula (Hill Notation): C₂₅₄H₃₇₇N₆₅O₇₅S₆

CAS No.:: 11070-73-8
Molecular Weight:: 5733.49

Compare	Product No.	Description	SDS	Pricing
	I0305000	European Pharmacopoeia (EP) Reference Standard

All Photos(1)

Insulin porcine for system suitability

Synonym(s): Insulin from porcine pancreas, Insulin from hog pancreas

Empirical Formula (Hill Notation): C₂₅₆H₃₈₁N₆₅O₇₆S₆

CAS No.:: 12584-58-6
Molecular Weight:: 5777.54

Compare	Product No.	Description		Pricing
	Y0001717	European Pharmacopoeia (EP) Reference Standard

All Photos(1)

Human Insulin

Synonym(s): Insulin human

Empirical Formula (Hill Notation): C₂₅₇H₃₈₃N₆₅O₇₇S₆

CAS No.:: 11061-68-0
Molecular Weight:: 5807.57

Compare	Product No.	Description	SDS	Pricing
	PHR8925	certified reference material, pharmaceutical secondary standard

All Photos(1)

Insulin (Pork)

Synonym(s): Insulin from porcine pancreas, Insulin from hog pancreas

Empirical Formula (Hill Notation): C₂₅₆H₃₈₁N₆₅O₇₆S₆

CAS No.:: 12584-58-6
Molecular Weight:: 5777.54

Compare	Product No.	Description	SDS	Pricing
	1342300	United States Pharmacopeia (USP) Reference Standard

All Photos(3)

PAMAM dendrimer, ethylenediamine core, generation 2.0 solution

Linear Formula: [NH₂(CH₂)₂NH₂]:(G=2);dendri PAMAM(NH₂)₁₆

CAS No.:: 93376-66-0
Molecular Weight:: 3256.18

Compare	Product No.	Description	SDS	Pricing
	412406	20 wt. % in methanol

All Photos(1)

PACAP 27 Amide, Ovine

Synonym(s): PACAP 27 Amide, Ovine

Empirical Formula (Hill Notation): C₁₄₂H₂₂₄N₄₀O₃₉S

CAS No.:: 127317-03-7
Molecular Weight:: 3147.61

Compare	Product No.	Description	SDS	Pricing
	05-23-2151	Increases cAMP levels in a dose-dependent manner (EC₅₀ = 4.7 nM).

All Photos(1)

Lactoferrin (from bovine milk)

CAS No.:: 146897-68-9

Compare	Product No.	Description	SDS	Pricing
	L-047	certified reference material, pkg of 50 mg, Cerilliant^®

All Photos(1)

Synonym(s): Calcitonin, Salmon, Thyrocalcitonin

Empirical Formula (Hill Notation): C₁₄₅H₂₄₀N₄₄O₄₈S₂

CAS No.:: 47931-85-1
Molecular Weight:: 3431.85

Compare	Product No.	Description	SDS	Pricing
	05-23-2401	Calcitonin, Salmon, CAS 47931-85-1, is a 32 amino acid synthetic calcitonin that is shown to stimulate bone formation and inhibit bone resorption. Has ability to cross mucous membranes.
	T3660	≥97% (HPLC), powder
	1086200	United States Pharmacopeia (USP) Reference Standard
	C0200000	European Pharmacopoeia (EP) Reference Standard

All Photos(1)

Lactoferrin (low Iron)

Synonym(s): Lactoferrin (from bovine milk)

CAS No.:: 146897-68-9

Compare	Product No.	Description		SDS	Pricing
	L-063	certified reference material, vial of 50 mg, Cerilliant^®

All Photos(1)

Empirical Formula (Hill Notation): C₁₅₇H₂₃₂N₄₀O₄₇S₂

CAS No.:: 30003-72-6
Molecular Weight:: 3495.89

Compare	Product No.	Description	SDS	Pricing
	I1764	BioReagent, suitable for protein sequencing
	I6383	≥80% (HPLC), powder

All Photos(1)

Astressin

Synonym(s): [D-Phe¹², Nle^21,38, Glu³⁰, Lys³³]-Corticotropin Releasing Factor fragment 12-41

Empirical Formula (Hill Notation): C₁₆₁H₂₆₉N₄₉O₄₂

CAS No.:: 170809-51-5
Molecular Weight:: 3563.16

Compare	Product No.	Description	SDS	Pricing
	A4933	≥90% (HPLC)

All Photos(1)

Glucagon, Human

Synonym(s): Glucagon, Human

Empirical Formula (Hill Notation): C₁₅₃H₂₂₅N₄₃O₄₉S

CAS No.:: 9007-92-5
Molecular Weight:: 3482.75

Compare	Product No.	Description	SDS	Pricing
	05-23-2700	Synthetic, human glucagon. Peptide hormone secreted by pancreatic α-cells. An important hyperglycemic agent.

All Photos(1)

Human glucagon

Synonym(s): Glucagon

Empirical Formula (Hill Notation): C₁₅₃H₂₂₅N₄₃O₄₉S

CAS No.:: 9007-92-5
Molecular Weight:: 3482.75

Compare	Product No.	Description		Pricing
	Y0000191	European Pharmacopoeia (EP) Reference Standard

All Photos(1)

Vasoactive Intestinal Peptide, Human, Porcine, and Rat

Synonym(s): Vasoactive Intestinal Peptide, Human, Porcine, and Rat

Empirical Formula (Hill Notation): C₁₄₇H₂₃₈N₄₄O₄₂S

CAS No.:: 40077-57-4
Molecular Weight:: 3325.80

Compare	Product No.	Description	SDS	Pricing
	05-23-2101	Acts as a mitogenic factor for embryonic neurons in the sympathetic nervous system.

All Photos(1)

ProteoMass^™ Insulin chain B oxidized MALDI-MS Standard

Synonym(s): Insulin Chain B Oxidized from bovine pancreas

Empirical Formula (Hill Notation): C₁₅₇H₂₃₂N₄₀O₄₇S₂

CAS No.:: 30003-72-6
Molecular Weight:: 3495.89

Compare	Product No.	Description	SDS	Pricing
	I6154	vial of 10 nmol

All Photos(1)

Exendin-4

Empirical Formula (Hill Notation): C₁₈₄H₂₈₂N₅₀O₆₀S

CAS No.:: 141758-74-9
Molecular Weight:: 4186.57

Compare	Product No.	Description	SDS	Pricing
	E7144	≥97%

All Photos(1)

Defensin HNP-2 human

Synonym(s): Neutrophil Peptide-2

Empirical Formula (Hill Notation): C₁₄₇H₂₁₇N₄₃O₃₇S₆

CAS No.:: 99287-07-7
Molecular Weight:: 3370.95

Compare	Product No.	Description	SDS	Pricing
	D6790	≥95% (HPLC)

All Photos(1)

SNX-482

Synonym(s): SNX-482

Empirical Formula (Hill Notation): C₁₉₂H₂₇₄N₅₂O₆₀S₇

CAS No.:: 203460-30-4
Molecular Weight:: 4495.00

Compare	Product No.	Description	SDS	Pricing
	5.08512

All Photos(1)

SNX-482 Recombinant

Synonym(s): GVDKAGCRYMFGGCSVNDDCCPRLGCHSLFSYCAWDLTFSD

Empirical Formula (Hill Notation): C₁₉₂H₂₇₄N₅₂O₆₀S₇

CAS No.:: 203460-30-4
Molecular Weight:: 4495.00

Compare	Product No.	Description	SDS	Pricing
	SML1150	≥98% (HPLC)

All Photos(1)

Exendin Fragment 9-39

Empirical Formula (Hill Notation): C₁₄₉H₂₃₄N₄₀O₄₇S

CAS No.:: 133514-43-9
Molecular Weight:: 3369.76

Compare	Product No.	Description	SDS	Pricing
	E7269	≥95% (HPLC)

All Photos(1)

Neuromedin U-25 porcine

Synonym(s): NMU-25

Empirical Formula (Hill Notation): C₁₄₄H₂₁₇N₄₃O₃₇

CAS No.:: 98395-76-7
Molecular Weight:: 3142.53

Compare	Product No.	Description	SDS	Pricing
	N8138	≥97% (HPLC), solid

All Photos(1)

Charybdotoxin

Empirical Formula (Hill Notation): C₁₇₆H₂₇₇N₅₇O₅₅S₇

CAS No.:: 95751-30-7
Molecular Weight:: 4295.89

Compare	Product No.	Description	SDS	Pricing
	C7802	≥90% (HPLC)

All Photos(1)

Synonym(s): NPY, hNPY, Neuropeptide Y, Human

Empirical Formula (Hill Notation): C₁₈₉H₂₈₅N₅₅O₅₇S

CAS No.:: 90880-35-6
Molecular Weight:: 4271.68

Compare	Product No.	Description	SDS	Pricing
	N5017	≥95% (HPLC), powder, synthetic
	05-23-2005	A potent vasoconstrictor.

Page 1 of 3

210-219-5

Insulin human

Insulin from bovine pancreas

Adrenocorticotropic Hormone human

Gastric Inhibitory Polypeptide human

ProteoMass™ Insulin MALDI-MS Standard

Insulin from porcine pancreas

Insulin, Human Recombinant

Insulin (bovine)

Insulin porcine for system suitability

Human Insulin

Insulin (Pork)

PAMAM dendrimer, ethylenediamine core, generation 2.0 solution

PACAP 27 Amide, Ovine

Lactoferrin (from bovine milk)

Calcitonin, Salmon

Lactoferrin (low Iron)

Insulin Chain B Oxidized from bovine pancreas

Astressin

Glucagon, Human

Human glucagon

Vasoactive Intestinal Peptide, Human, Porcine, and Rat

ProteoMass™ Insulin chain B oxidized MALDI-MS Standard

Exendin-4

Defensin HNP-2 human

SNX-482

SNX-482 Recombinant

Exendin Fragment 9-39

Neuromedin U-25 porcine

Charybdotoxin

Neuropeptide Y human

ProteoMass^™ Insulin MALDI-MS Standard

ProteoMass^™ Insulin chain B oxidized MALDI-MS Standard