MilliporeSigma
Search Within
Shipping
Product Category
Brand
Biological Source
Color
Formula Weight
Gene Alias
Manufacturer
Physical Form
Purity
Activity Spectrum
Format
Quality Segment
Application
Markush Group
Reference Material Type
Special Grade
Technique
Available for Sale

213-207-8

Applied Filters:
Keyword:'213-207-8'
Showing 1-30 of 69 results for "213-207-8" within Products
All Photos(1)

2-Mercaptopyrazine

Empirical Formula (Hill Notation): C4H4N2S
CAS No.:
38521-06-1
Molecular Weight:
112.15
CompareProduct No.DescriptionPricing
79183097% (HPLC)
All Photos(1)

α-Naphtholbenzein

Synonym(s): 4,4′-(α-Hydroxybenzylidene)di-1-naphthol, p-naphtholbenzein
Empirical Formula (Hill Notation): C27H18O2
CAS No.:
145-50-6
Molecular Weight:
374.43
EC No.:
205-656-3
Beilstein No.:
2628063
CompareProduct No.DescriptionSDSPricing
291099indicator grade
All Photos(4)

Synonym(s): Behenic acid methyl ester, Docosanoic acid methyl ester, Methyl docosanoate
Linear Formula: CH3(CH2)20COOCH3
CAS No.:
929-77-1
Molecular Weight:
354.61
EC No.:
213-207-8
Beilstein No.:
1795147
CompareProduct No.DescriptionSDSPricing
B3271≥98.5% (capillary GC)
11940analytical standard
All Photos(1)

PACAP 27 Amide, Ovine

Synonym(s): PACAP 27 Amide, Ovine
Empirical Formula (Hill Notation): C142H224N40O39S
CAS No.:
127317-03-7
Molecular Weight:
3147.61
All Photos(3)

PAMAM dendrimer, ethylenediamine core, generation 2.0 solution

Linear Formula: [NH2(CH2)2NH2]:(G=2);dendri PAMAM(NH2)16
CAS No.:
93376-66-0
Molecular Weight:
3256.18
CompareProduct No.DescriptionSDSPricing
41240620 wt. % in methanol
All Photos(1)

Lactoferrin (from bovine milk)

CAS No.:
146897-68-9
CompareProduct No.DescriptionSDSPricing
L-047certified reference material, pkg of 50 mg, Cerilliant®
All Photos(1)

Empirical Formula (Hill Notation): C157H232N40O47S2
CAS No.:
30003-72-6
Molecular Weight:
3495.89
All Photos(1)

Glucagon, Human

Synonym(s): Glucagon, Human
Empirical Formula (Hill Notation): C153H225N43O49S
CAS No.:
9007-92-5
Molecular Weight:
3482.75
All Photos(1)

Astressin

Synonym(s): [D-Phe12, Nle21,38, Glu30, Lys33]-Corticotropin Releasing Factor fragment 12-41
Empirical Formula (Hill Notation): C161H269N49O42
CAS No.:
170809-51-5
Molecular Weight:
3563.16
CompareProduct No.DescriptionSDSPricing
A4933≥90% (HPLC)
All Photos(1)

Human glucagon

Synonym(s): Glucagon
Empirical Formula (Hill Notation): C153H225N43O49S
CAS No.:
9007-92-5
Molecular Weight:
3482.75
CompareProduct No.DescriptionPricing
Y0000191European Pharmacopoeia (EP) Reference Standard
All Photos(1)

Vasoactive Intestinal Peptide, Human, Porcine, and Rat

Synonym(s): Vasoactive Intestinal Peptide, Human, Porcine, and Rat
Empirical Formula (Hill Notation): C147H238N44O42S
CAS No.:
40077-57-4
Molecular Weight:
3325.80
All Photos(1)

ProteoMass Insulin chain B oxidized MALDI-MS Standard

Synonym(s): Insulin Chain B Oxidized from bovine pancreas
Empirical Formula (Hill Notation): C157H232N40O47S2
CAS No.:
30003-72-6
Molecular Weight:
3495.89
CompareProduct No.DescriptionSDSPricing
I6154vial of 10 nmol
All Photos(1)

Hyperbranched bis-MPA polyester-32-hydroxyl, generation 3

Synonym(s): ALH-32-OH, Hyperbranched Polymer, Hyperpolymer, PFH-32-OH
Empirical Formula (Hill Notation): C155H256O93
CAS No.:
326794-48-3
Molecular Weight:
3607.64
CompareProduct No.DescriptionSDSPricing
686581≥97%
All Photos(1)

Exendin-4

Empirical Formula (Hill Notation): C184H282N50O60S
CAS No.:
141758-74-9
Molecular Weight:
4186.57
CompareProduct No.DescriptionSDSPricing
E7144≥97%
All Photos(1)

Defensin HNP-2 human

Synonym(s): Neutrophil Peptide-2
Empirical Formula (Hill Notation): C147H217N43O37S6
CAS No.:
99287-07-7
Molecular Weight:
3370.95
CompareProduct No.DescriptionSDSPricing
D6790≥95% (HPLC)
All Photos(1)

SNX-482 Recombinant

Synonym(s): GVDKAGCRYMFGGCSVNDDCCPRLGCHSLFSYCAWDLTFSD
Empirical Formula (Hill Notation): C192H274N52O60S7
CAS No.:
203460-30-4
Molecular Weight:
4495.00
CompareProduct No.DescriptionSDSPricing
SML1150≥98% (HPLC)
All Photos(1)

SNX-482

Synonym(s): SNX-482
Empirical Formula (Hill Notation): C192H274N52O60S7
CAS No.:
203460-30-4
Molecular Weight:
4495.00
CompareProduct No.DescriptionSDSPricing
5.08512
All Photos(1)

Neuromedin U-25 porcine

Synonym(s): NMU-25
Empirical Formula (Hill Notation): C144H217N43O37
CAS No.:
98395-76-7
Molecular Weight:
3142.53
CompareProduct No.DescriptionSDSPricing
N8138≥97% (HPLC), solid
All Photos(1)

Synonym(s): Neuropeptide Y, Human, NPY, hNPY
Empirical Formula (Hill Notation): C189H285N55O57S
CAS No.:
90880-35-6
Molecular Weight:
4271.68
All Photos(1)

Adrenocorticotropic Hormone human

Synonym(s): Adrenocorticotropic hormone fragment 1-39, Corticotropin A
Empirical Formula (Hill Notation): C207H308N56O58S
CAS No.:
12279-41-3
Molecular Weight:
4541.07
CompareProduct No.DescriptionSDSPricing
A0423≥97% (HPLC)
All Photos(1)

Nisin Ready Made Solution

Empirical Formula (Hill Notation): C143H230N42O37S7
CAS No.:
1414-45-5
Molecular Weight:
3354.07
CompareProduct No.DescriptionSDSPricing
SBR00021(20,000-40,000 IU/mL in 0.02N HCl)
All Photos(1)

Atrial Natriuretic Peptide human

Synonym(s): ANF 1-28, hANF
Empirical Formula (Hill Notation): C127H203N45O39S3
CAS No.:
91917-63-4
Molecular Weight:
3080.44
CompareProduct No.DescriptionSDSPricing
A1663≥97% (HPLC)
All Photos(1)

Calcitonin human

Synonym(s): Calcitonin M, human C carcinoma, Calcitonin, human reduced cyclic (1→7)-disulfide, Thyrocalcitonin, hCT
Empirical Formula (Hill Notation): C151H226N40O45S3
CAS No.:
21215-62-3
Molecular Weight:
3417.85
EC No.:
244-276-2
CompareProduct No.DescriptionSDSPricing
T3535≥97% (HPLC), powder
All Photos(1)

Cecropin A

Empirical Formula (Hill Notation): C184H313N53O46
CAS No.:
80451-04-3
Molecular Weight:
4003.78
CompareProduct No.DescriptionSDSPricing
C6830≥97% (HPLC), powder
All Photos(1)

Synonym(s): Parathyroid Hormone Fragment 1-34 human, PTH 1-34, Parathormone (1-34)
Empirical Formula (Hill Notation): C181H291N55O51S2
CAS No.:
52232-67-4
Molecular Weight:
4117.72
All Photos(1)

Pramlintide acetate salt

Synonym(s): 25,28,29 TriPro-amylin (human) acetate, AC 0137, AC 137, AC0137, AC137, TriPro-amylin acetate, [Pro25,28,29]-amylin (human) acetate
Empirical Formula (Hill Notation): C171H267N51O53S2
CAS No.:
187887-46-3
Molecular Weight:
3949.39
CompareProduct No.DescriptionSDSPricing
SML2523≥95% (HPLC)
All Photos(1)

Charybdotoxin

Empirical Formula (Hill Notation): C176H277N57O55S7
CAS No.:
95751-30-7
Molecular Weight:
4295.89
CompareProduct No.DescriptionSDSPricing
C7802≥90% (HPLC)
All Photos(1)

Chlorotoxin from Leiurus quinquestriatus (north Africa)

Empirical Formula (Hill Notation): C158H256N52O48S11
CAS No.:
163515-35-3
Molecular Weight:
4004.76
All Photos(1)

Calcitonin Gene Related Peptide human

Synonym(s): α-CGRP, CGRP-I
Empirical Formula (Hill Notation): C163H267N51O49S2
CAS No.:
90954-53-3
Molecular Weight:
3789.31
CompareProduct No.DescriptionSDSPricing
C0167≥95% (HPLC), powder
Page 1 of 3