MilliporeSigma
Search Within
Shipping
Product Category
Brand
Biological Source
Color
Feature
Formula Weight
Gene Alias
Manufacturer
Physical Form
Purity
Activity Spectrum
Format
Quality Segment
Application
API Family
Reference Material Type
Special Grade
Sterility
Technique
Available for Sale

215-233-5

Applied Filters:
Keyword:'215-233-5'
Showing 1-30 of 50 results for "215-233-5" within Products
All Photos(1)

Vasoactive Intestinal Peptide, Human, Porcine, and Rat

Synonym(s): Vasoactive Intestinal Peptide, Human, Porcine, and Rat
Empirical Formula (Hill Notation): C147H238N44O42S
CAS No.:
40077-57-4
Molecular Weight:
3325.80
All Photos(1)

Glucagon, Human

Synonym(s): Glucagon, Human
Empirical Formula (Hill Notation): C153H225N43O49S
CAS No.:
9007-92-5
Molecular Weight:
3482.75
All Photos(1)

Exenatide

Synonym(s): Exendin-4
Empirical Formula (Hill Notation): C184H282N50O60S
CAS No.:
141758-74-9
Molecular Weight:
4186.57
CompareProduct No.DescriptionPricing
1269105United States Pharmacopeia (USP) Reference Standard
All Photos(1)

Proinsulin C-Peptide (55-89) human

Synonym(s): Proinsulin connecting peptide
Empirical Formula (Hill Notation): C153H259N49O52
CAS No.:
11097-48-6
Molecular Weight:
3616.99
CompareProduct No.DescriptionSDSPricing
C4999bioactive peptide hormone
All Photos(1)

Parathyroid Hormone Fragment 1-34 bovine

Empirical Formula (Hill Notation): C183H288N54O50S2
CAS No.:
12583-68-5
Molecular Weight:
4108.71
CompareProduct No.DescriptionSDSPricing
P3671≥97% (HPLC), powder
All Photos(5)

Synonym(s): Yttria
Linear Formula: Y2O3
CAS No.:
1314-36-9
Molecular Weight:
225.81
EC No.:
215-233-5
CompareProduct No.DescriptionSDSPricing
20516899.99% trace metals basis
544892nanopowder, <50 nm particle size
20492799.999% trace metals basis
All Photos(1)

SNX-482

Synonym(s): SNX-482
Empirical Formula (Hill Notation): C192H274N52O60S7
CAS No.:
203460-30-4
Molecular Weight:
4495.00
CompareProduct No.DescriptionSDSPricing
5.08512
All Photos(1)

Cecropin P1 Porcine

Empirical Formula (Hill Notation): C147H253N45O43
CAS No.:
125667-96-1
Molecular Weight:
3338.86
CompareProduct No.DescriptionSDSPricing
C7927≥95% (HPLC), powder
All Photos(1)

Defensin HNP-2 human

Synonym(s): Neutrophil Peptide-2
Empirical Formula (Hill Notation): C147H217N43O37S6
CAS No.:
99287-07-7
Molecular Weight:
3370.95
CompareProduct No.DescriptionSDSPricing
D6790≥95% (HPLC)
All Photos(1)

SNX-482 Recombinant

Synonym(s): GVDKAGCRYMFGGCSVNDDCCPRLGCHSLFSYCAWDLTFSD
Empirical Formula (Hill Notation): C192H274N52O60S7
CAS No.:
203460-30-4
Molecular Weight:
4495.00
CompareProduct No.DescriptionSDSPricing
SML1150≥98% (HPLC)
All Photos(1)

Glucagon-Like Peptide I human

Synonym(s): GLP-1, Preproglucagon 72-108
Empirical Formula (Hill Notation): C186H275N51O59
CAS No.:
87805-34-3
Molecular Weight:
4169.48
CompareProduct No.DescriptionSDSPricing
G3265≥97% (HPLC)
All Photos(1)

Parathyroid Hormone 1-34, Human

Synonym(s): Parathyroid Hormone 1-34, Human
Empirical Formula (Hill Notation): C181H291N55O51S2
CAS No.:
52232-67-4
Molecular Weight:
4117.72
All Photos(1)

Glucagon-Like Peptide I Amide Fragment 7-36 human

Synonym(s): Preproglucagon 78-107 Amide
Empirical Formula (Hill Notation): C149H226N40O45
CAS No.:
107444-51-9
Molecular Weight:
3297.63
CompareProduct No.DescriptionSDSPricing
G8147≥97% (HPLC), powder
All Photos(1)

Brain Natriuretic Peptide-32 human

Synonym(s): BNP-32
Empirical Formula (Hill Notation): C143H244N50O42S4
CAS No.:
124584-08-3
Molecular Weight:
3464.04
CompareProduct No.DescriptionSDSPricing
B5900≥97% (HPLC), powder
All Photos(1)

Exendin-4

Empirical Formula (Hill Notation): C184H282N50O60S
CAS No.:
141758-74-9
Molecular Weight:
4186.57
CompareProduct No.DescriptionSDSPricing
E7144≥97%
All Photos(1)

Orexin A human, rat, mouse

Empirical Formula (Hill Notation): C152H243N47O44S4
CAS No.:
205599-75-3
Molecular Weight:
3561.10
CompareProduct No.DescriptionSDSPricing
O6012≥97% (HPLC)
All Photos(1)

ProteoMass Insulin chain B oxidized MALDI-MS Standard

Synonym(s): Insulin Chain B Oxidized from bovine pancreas
Empirical Formula (Hill Notation): C157H232N40O47S2
CAS No.:
30003-72-6
Molecular Weight:
3495.89
CompareProduct No.DescriptionSDSPricing
I6154vial of 10 nmol
All Photos(1)

Synonym(s): Parathyroid Hormone Fragment 1-34 human, PTH 1-34, Parathormone (1-34)
Empirical Formula (Hill Notation): C181H291N55O51S2
CAS No.:
52232-67-4
Molecular Weight:
4117.72
All Photos(1)

Calcitonin Gene-Related Peptide-I, Human

Synonym(s): Calcitonin Gene-Related Peptide-I, Human
Empirical Formula (Hill Notation): C163H267N51O49S2
CAS No.:
90954-53-3
Molecular Weight:
3789.31
All Photos(1)

Exendin Fragment 9-39

Empirical Formula (Hill Notation): C149H234N40O47S
CAS No.:
133514-43-9
Molecular Weight:
3369.76
CompareProduct No.DescriptionSDSPricing
E7269≥95% (HPLC)
All Photos(1)

Chlorotoxin from Leiurus quinquestriatus (north Africa)

Empirical Formula (Hill Notation): C158H256N52O48S11
CAS No.:
163515-35-3
Molecular Weight:
4004.76
CompareProduct No.DescriptionSDSPricing
C5238recombinant, expressed in E. coli, ≥98% (HPLC), lyophilized powder
All Photos(1)

Synonym(s): Neuropeptide Y, Human, NPY, hNPY
Empirical Formula (Hill Notation): C189H285N55O57S
CAS No.:
90880-35-6
Molecular Weight:
4271.68
CompareProduct No.DescriptionSDSPricing
05-23-2005A potent vasoconstrictor.
N5017≥95% (HPLC), powder, synthetic
All Photos(1)

Adrenocorticotropic Hormone human

Synonym(s): Adrenocorticotropic hormone fragment 1-39, Corticotropin A
Empirical Formula (Hill Notation): C207H308N56O58S
CAS No.:
12279-41-3
Molecular Weight:
4541.07
CompareProduct No.DescriptionSDSPricing
A0423≥97% (HPLC)
All Photos(1)

Iberiotoxin, Buthus tamulus, Recombinant, E. coli

Synonym(s): Iberiotoxin, Buthus tamulus, Recombinant, E. coli
CAS No.:
129203-60-7
CompareProduct No.DescriptionSDSPricing
401002
All Photos(1)

Human glucagon

Synonym(s): Glucagon
Empirical Formula (Hill Notation): C153H225N43O49S
CAS No.:
9007-92-5
Molecular Weight:
3482.75
CompareProduct No.DescriptionPricing
Y0000191European Pharmacopoeia (EP) Reference Standard
All Photos(1)

Urodilatin human

Synonym(s): Thr-Ala-Pro-Arg-Atrial Natriuretic Peptide
Empirical Formula (Hill Notation): C145H234N52O44S3
CAS No.:
115966-23-9
Molecular Weight:
3505.93
CompareProduct No.DescriptionSDSPricing
U5754≥97% (HPLC)
All Photos(1)

Teriparatide for system suitability

Synonym(s): Parathyroid Hormone Fragment 1-34 human, PTH 1-34, Parathormone (1-34)
Empirical Formula (Hill Notation): C181H291N55O51S2
CAS No.:
52232-67-4
Molecular Weight:
4117.72
CompareProduct No.DescriptionSDSPricing
Y0001895European Pharmacopoeia (EP) Reference Standard
All Photos(1)

rGlucagon, recombinant glucagon (human)

Synonym(s): Glucagon
Empirical Formula (Hill Notation): C153H225N43O49S
CAS No.:
16941-32-5
Molecular Weight:
3482.75
CompareProduct No.DescriptionSDSPricing
1294036United States Pharmacopeia (USP) Reference Standard
All Photos(1)

Calcitonin Gene Related Peptide human

Synonym(s): α-CGRP, CGRP-I
Empirical Formula (Hill Notation): C163H267N51O49S2
CAS No.:
90954-53-3
Molecular Weight:
3789.31
CompareProduct No.DescriptionSDSPricing
C0167≥95% (HPLC), powder
Page 1 of 2