MilliporeSigma
Search Within
Shipping
Product Category
Brand
Color
Formula Weight
Gene Alias
Melting Point (°C)
Physical Form
Purity
Recombinant Host
Research Area
Quality Segment
Application
Available for Sale

215-295-3

Applied Filters:
Keyword:'215-295-3'
Showing 1-10 of 10 results for "215-295-3" within Products
All Photos(3)

Synonym(s): 1-([4-(Xylylazo)xylyl]azo)-2-naphthol, 1-[2,5-Dimethyl-4-(2,5-dimethylphenylazo)phenylazo]-2-naphthol, Solvent Red 27
Empirical Formula (Hill Notation): C26H24N4O
CAS No.:
1320-06-5
Molecular Weight:
408.49
EC No.:
215-295-3
All Photos(1)

SNX-482

Synonym(s): SNX-482
Empirical Formula (Hill Notation): C192H274N52O60S7
CAS No.:
203460-30-4
Molecular Weight:
4495.00
CompareProduct No.DescriptionSDSPricing
5.08512
All Photos(1)

Exendin-4

Empirical Formula (Hill Notation): C184H282N50O60S
CAS No.:
141758-74-9
Molecular Weight:
4186.57
CompareProduct No.DescriptionSDSPricing
E7144≥97%
All Photos(1)

Exenatide

Synonym(s): Exendin-4
Empirical Formula (Hill Notation): C184H282N50O60S
CAS No.:
141758-74-9
Molecular Weight:
4186.57
CompareProduct No.DescriptionPricing
1269105United States Pharmacopeia (USP) Reference Standard
All Photos(1)

SNX-482 Recombinant

Synonym(s): GVDKAGCRYMFGGCSVNDDCCPRLGCHSLFSYCAWDLTFSD
Empirical Formula (Hill Notation): C192H274N52O60S7
CAS No.:
203460-30-4
Molecular Weight:
4495.00
CompareProduct No.DescriptionSDSPricing
SML1150≥98% (HPLC)
All Photos(1)

Synonym(s): Neuropeptide Y, Human, NPY, hNPY
Empirical Formula (Hill Notation): C189H285N55O57S
CAS No.:
90880-35-6
Molecular Weight:
4271.68
All Photos(1)

Adrenocorticotropic Hormone human

Synonym(s): Adrenocorticotropic hormone fragment 1-39, Corticotropin A
Empirical Formula (Hill Notation): C207H308N56O58S
CAS No.:
12279-41-3
Molecular Weight:
4541.07
CompareProduct No.DescriptionSDSPricing
A0423≥97% (HPLC)
All Photos(1)

Charybdotoxin

Empirical Formula (Hill Notation): C176H277N57O55S7
CAS No.:
95751-30-7
Molecular Weight:
4295.89
CompareProduct No.DescriptionSDSPricing
C7802≥90% (HPLC)
All Photos(1)

Glucagon-Like Peptide I human

Synonym(s): GLP-1, Preproglucagon 72-108
Empirical Formula (Hill Notation): C186H275N51O59
CAS No.:
87805-34-3
Molecular Weight:
4169.48
CompareProduct No.DescriptionSDSPricing
G3265≥97% (HPLC)
All Photos(1)

bis-MPA-Acetylene dendrimer

Empirical Formula (Hill Notation): C279H326O138
Molecular Weight:
5887.49
CompareProduct No.DescriptionSDSPricing
806153trimethylol propane core, generation 3
Page 1 of 1