215-295-3

Applied Filters:

Keyword:'215-295-3'

Showing 1-30 of 103 results for "215-295-3" within Products

All Photos(13)

Empirical Formula (Hill Notation): C₂₅₄H₃₇₇N₆₅O₇₅S₆

CAS No.:: 11070-73-8
Molecular Weight:: 5733.49
EC No.:: 234-291-2

Product No.	Biological Source	Form	Assay
I6634	bovine	powder	—
I5500	—	powder	—
I4011	bovine	powder	—

All Photos(7)

Synonym(s): Insulin human

Empirical Formula (Hill Notation): C₂₅₇H₃₈₃N₆₅O₇₇S₆

CAS No.:: 11061-68-0
Molecular Weight:: 5807.57

Compare	Product No.	Description					SDS	Pricing
	I1507	≥95% (HPLC), semisynthetic, powder, non-sterile
	I2643	recombinant, expressed in yeast (proprietary host)
	11376497001	recombinant (yeast)
	I0908	meets USP testing specifications
	1342106	United States Pharmacopeia (USP) Reference Standard

All Photos(1)

Adrenocorticotropic Hormone human

Synonym(s): Adrenocorticotropic hormone fragment 1-39, Corticotropin A

Empirical Formula (Hill Notation): C₂₀₇H₃₀₈N₅₆O₅₈S

CAS No.:: 12279-41-3
Molecular Weight:: 4541.07

Compare	Product No.	Biological Source	Form	Assay					SDS	Pricing
	A0423	synthetic (organic)	powder	≥97% (HPLC)

All Photos(1)

Insulin, Human Recombinant

Synonym(s): Insulin sodium salt human

CAS No.:: 11061-68-0
EC No.:: 234-279-7

Compare	Product No.	Description					SDS	Pricing
	91077C	for research or for further manufacturing use, dry powder

All Photos(1)

Gastric Inhibitory Polypeptide human

Synonym(s): GIP, Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln

Empirical Formula (Hill Notation): C₂₂₆H₃₃₈N₆₀O₆₆S

CAS No.:: 100040-31-1
Molecular Weight:: 4983.53

Compare	Product No.	Description					SDS	Pricing
	G2269	≥95% (HPLC), suitable for ligand binding assays

All Photos(1)

ProteoMass^™ Insulin MALDI-MS Standard

Synonym(s): Insulin from bovine pancreas

Empirical Formula (Hill Notation): C₂₅₄H₃₇₇N₆₅O₇₅S₆

CAS No.:: 11070-73-8
Molecular Weight:: 5733.49
EC No.:: 234-291-2

Compare	Product No.	Description					SDS	Pricing
	I6279	vial of 10 nmol, monoisotopic mol wt 5,729.6087 Da

All Photos(2)

Insulin from porcine pancreas

Synonym(s): Insulin from hog pancreas

Empirical Formula (Hill Notation): C₂₅₆H₃₈₁N₆₅O₇₆S₆

CAS No.:: 12584-58-6
Molecular Weight:: 5777.54
EC No.:: 235-703-3

Compare	Product No.	Biological Source	Form	Assay					SDS	Pricing
	I5523	Porcine pancreas	powder	≥98%

All Photos(1)

Human Insulin

Synonym(s): Insulin human

Empirical Formula (Hill Notation): C₂₅₇H₃₈₃N₆₅O₇₇S₆

CAS No.:: 11061-68-0
Molecular Weight:: 5807.57

Compare	Product No.	Description					SDS	Pricing
	PHR8925	certified reference material, pharmaceutical secondary standard

All Photos(1)

Insulin porcine for system suitability

Synonym(s): Insulin from porcine pancreas, Insulin from hog pancreas

Empirical Formula (Hill Notation): C₂₅₆H₃₈₁N₆₅O₇₆S₆

CAS No.:: 12584-58-6
Molecular Weight:: 5777.54

Compare	Product No.	Description						Pricing
	Y0001717	European Pharmacopoeia (EP) Reference Standard

All Photos(1)

Insulin (Pork)

Synonym(s): Insulin from porcine pancreas, Insulin from hog pancreas

Empirical Formula (Hill Notation): C₂₅₆H₃₈₁N₆₅O₇₆S₆

CAS No.:: 12584-58-6
Molecular Weight:: 5777.54

Compare	Product No.	Description					SDS	Pricing
	1342300	United States Pharmacopeia (USP) Reference Standard

All Photos(1)

Exendin-4

Empirical Formula (Hill Notation): C₁₈₄H₂₈₂N₅₀O₆₀S

CAS No.:: 141758-74-9
Molecular Weight:: 4186.57

Compare	Product No.	Description					SDS	Pricing
	E7144	≥97%

All Photos(1)

ACTH (1-39) human

CAS No.:: 12279-41-3
Molecular Weight:: 4541.13

Compare	Product No.	Description						Pricing
	TA9H97BAEE2C

All Photos(1)

GIP (3-42), human

CAS No.:: 1802086-25-4
Molecular Weight:: 4749.34

Compare	Product No.	Description						Pricing
	AABH9A959AB2

All Photos(1)

CART(55-102)(human)

CAS No.:: 214050-22-3
Molecular Weight:: 5245.23

Compare	Product No.	Description						Pricing
	AABH9A955D1E

All Photos(1)

CART(55-102)(rat)

CAS No.:: 209615-79-2
Molecular Weight:: 5259.26

Compare	Product No.	Description						Pricing
	AABH9A955D1B

All Photos(1)

Exendin-4

CAS No.:: 141758-74-9
Molecular Weight:: 4186.63

Compare	Product No.	Description						Pricing
	TA9H11E41AD2

All Photos(1)

Human PTHrP-(1-36)

CAS No.:: 172867-62-8
Molecular Weight:: 4259.89

Compare	Product No.	Description						Pricing
	AABH9A955929

All Photos(1)

SNX-482 Recombinant

Synonym(s): GVDKAGCRYMFGGCSVNDDCCPRLGCHSLFSYCAWDLTFSD

Empirical Formula (Hill Notation): C₁₉₂H₂₇₄N₅₂O₆₀S₇

CAS No.:: 203460-30-4
Molecular Weight:: 4495.00

Compare	Product No.	Assay	Form	Quality Level	Storage Condition					SDS	Pricing
	SML1150	≥98% (HPLC)	lyophilized powder	100	—

All Photos(1)

SNX-482

Synonym(s): SNX-482

Empirical Formula (Hill Notation): C₁₉₂H₂₇₄N₅₂O₆₀S₇

CAS No.:: 203460-30-4
Molecular Weight:: 4495.00

Compare	Product No.	Assay	Form	Quality Level	Storage Condition					SDS	Pricing
	5.08512	≥97% (HPLC)	solid	100	OK to freeze, protect from light

All Photos(1)

Neuropeptide Y(29-64)

CAS No.:: 303052-45-1
Molecular Weight:: 4272.73

Compare	Product No.	Description						Pricing
	AABH9A959D4F

All Photos(1)

Tirzepatide Acetate(2023788-19-2 free base)

Molecular Weight:: 4873.57

Compare	Product No.	Description						Pricing
	TA9H97F3118A

All Photos(1)

Î²-Amyloid (1-42), human

CAS No.:: 107761-42-2
Molecular Weight:: 4514.1

Compare	Product No.	Description						Pricing
	AABH9A9582D6

All Photos(1)

Î²-Amyloid (42-1), human

CAS No.:: 317366-82-8
Molecular Weight:: 4514.1

Compare	Product No.	Description						Pricing
	AABH9A9560B4

All Photos(1)

Charybdotoxin

Empirical Formula (Hill Notation): C₁₇₆H₂₇₇N₅₇O₅₅S₇

CAS No.:: 95751-30-7
Molecular Weight:: 4295.89

Compare	Product No.	Description					SDS	Pricing
	C7802	≥90% (HPLC), voltage-gated potassium channel blocker, powder

All Photos(1)

AMYLOID BETA-PROTEIN (40-1)

CAS No.:: 144409-99-4
Molecular Weight:: 4329.86

Compare	Product No.	Description						Pricing
	AABH9BD8F866

All Photos(1)

bis-MPA-Acetylene dendrimer

Empirical Formula (Hill Notation): C₂₇₉H₃₂₆O₁₃₈

Molecular Weight:: 5887.49

Compare	Product No.	Description					SDS	Pricing
	806153	trimethylol propane core, generation 3

All Photos(1)

Glucagon-Like Peptide I human

Synonym(s): GLP-1, Preproglucagon 72-108

Empirical Formula (Hill Notation): C₁₈₆H₂₇₅N₅₁O₅₉

CAS No.:: 87805-34-3
Molecular Weight:: 4169.48

Compare	Product No.	Description					SDS	Pricing
	G3265	≥97% (HPLC)

All Photos(1)

Apelin-36(human)

CAS No.:: 252642-12-9
Molecular Weight:: 4195.88

Compare	Product No.	Description						Pricing
	AABH9A954264

All Photos(1)

[cPP1-7,NPY19-23,Ala31,Aib32,Gln34]-hPancreatic Polypeptide

CAS No.:: 313988-89-5
Molecular Weight:: 4207.73

Compare	Product No.	Description						Pricing
	AABH97D31CD8

All Photos(1)

Î²-Amyloid (1-42), (rat/mouse)

CAS No.:: 166090-74-0
Molecular Weight:: 4418.01

Compare	Product No.	Description						Pricing
	AABH9A955BAC

Page 1 of 4

215-295-3

Insulin from bovine pancreas

Insulin human

Adrenocorticotropic Hormone human

Insulin, Human Recombinant

Gastric Inhibitory Polypeptide human

ProteoMass™ Insulin MALDI-MS Standard

Insulin from porcine pancreas

Human Insulin

Insulin porcine for system suitability

Insulin (Pork)

Exendin-4

ACTH (1-39) human

GIP (3-42), human

CART(55-102)(human)

CART(55-102)(rat)

Exendin-4

Human PTHrP-(1-36)

SNX-482 Recombinant

SNX-482

Neuropeptide Y(29-64)

Tirzepatide Acetate(2023788-19-2 free base)

Î²-Amyloid (1-42), human

Î²-Amyloid (42-1), human

Charybdotoxin

AMYLOID BETA-PROTEIN (40-1)

bis-MPA-Acetylene dendrimer

Glucagon-Like Peptide I human

Apelin-36(human)

[cPP1-7,NPY19-23,Ala31,Aib32,Gln34]-hPancreatic Polypeptide

Î²-Amyloid (1-42), (rat/mouse)

ProteoMass^™ Insulin MALDI-MS Standard