MilliporeSigma
Search Within
Shipping
Product Category
Brand
Biological Source
Color
Formula Weight
Gene Alias
Melting Point (°C)
Physical Form
Purity
Recombinant Host
Research Area
Quality Segment
Markush Class
Markush Group
Polymer Composition
Polymer Type
Sterility
Available for Sale

226-296-3

Applied Filters:
Keyword:'226-296-3'
Showing 1-7 of 7 results for "226-296-3" within Products
All Photos(1)

2-Aminopyridine-3-carboxylic acid

Synonym(s): 2-Aminonicotinic acid, 2-Aminopyridine-3-carboxylic acid
Empirical Formula (Hill Notation): C6H6N2O2
CAS No.:
5345-47-1
Molecular Weight:
138.12
EC No.:
226-296-3
Beilstein No.:
119031
CompareProduct No.DescriptionSDSPricing
A6830098%
All Photos(1)

SNX-482 Recombinant

Synonym(s): GVDKAGCRYMFGGCSVNDDCCPRLGCHSLFSYCAWDLTFSD
Empirical Formula (Hill Notation): C192H274N52O60S7
CAS No.:
203460-30-4
Molecular Weight:
4495.00
CompareProduct No.DescriptionSDSPricing
SML1150≥98% (HPLC)
All Photos(1)

SNX-482

Synonym(s): SNX-482
Empirical Formula (Hill Notation): C192H274N52O60S7
CAS No.:
203460-30-4
Molecular Weight:
4495.00
CompareProduct No.DescriptionSDSPricing
5.08512
All Photos(1)

Synonym(s): Neuropeptide Y, Human, NPY, hNPY
Empirical Formula (Hill Notation): C189H285N55O57S
CAS No.:
90880-35-6
Molecular Weight:
4271.68
All Photos(1)

Adrenocorticotropic Hormone human

Synonym(s): Adrenocorticotropic hormone fragment 1-39, Corticotropin A
Empirical Formula (Hill Notation): C207H308N56O58S
CAS No.:
12279-41-3
Molecular Weight:
4541.07
CompareProduct No.DescriptionSDSPricing
A0423≥97% (HPLC)
All Photos(1)

bis-MPA-Acetylene dendrimer

Empirical Formula (Hill Notation): C279H326O138
Molecular Weight:
5887.49
CompareProduct No.DescriptionSDSPricing
806153trimethylol propane core, generation 3
All Photos(1)

Glucagon-Like Peptide I human

Synonym(s): GLP-1, Preproglucagon 72-108
Empirical Formula (Hill Notation): C186H275N51O59
CAS No.:
87805-34-3
Molecular Weight:
4169.48
CompareProduct No.DescriptionSDSPricing
G3265≥97% (HPLC)
Page 1 of 1