MilliporeSigma
Search Within
Shipping
Product Category
Brand
Biological Source
Color
Formula Weight
Gene Alias
Manufacturer
Physical Form
Purity
Format
Quality Segment
Application
API Family
Reference Material Type
Special Grade
Technique
Available for Sale

230-241-9

Applied Filters:
Keyword:'230-241-9'
Showing 1-30 of 38 results for "230-241-9" within Products
All Photos(1)

Ethylene glycol methyl ether methacrylate

Synonym(s): 2-Methoxyethyl methacrylate
Linear Formula: H2C=C(CH3)CO2CH2CH2OCH3
CAS No.:
6976-93-8
Molecular Weight:
144.17
EC No.:
230-241-9
CompareProduct No.DescriptionSDSPricing
41533299%
All Photos(1)

Empirical Formula (Hill Notation): C157H232N40O47S2
CAS No.:
30003-72-6
Molecular Weight:
3495.89
All Photos(1)

Glucagon, Human

Synonym(s): Glucagon, Human
Empirical Formula (Hill Notation): C153H225N43O49S
CAS No.:
9007-92-5
Molecular Weight:
3482.75
All Photos(1)

Astressin

Synonym(s): [D-Phe12, Nle21,38, Glu30, Lys33]-Corticotropin Releasing Factor fragment 12-41
Empirical Formula (Hill Notation): C161H269N49O42
CAS No.:
170809-51-5
Molecular Weight:
3563.16
CompareProduct No.DescriptionSDSPricing
A4933≥90% (HPLC)
All Photos(1)

Human glucagon

Synonym(s): Glucagon
Empirical Formula (Hill Notation): C153H225N43O49S
CAS No.:
9007-92-5
Molecular Weight:
3482.75
CompareProduct No.DescriptionPricing
Y0000191European Pharmacopoeia (EP) Reference Standard
All Photos(1)

ProteoMass Insulin chain B oxidized MALDI-MS Standard

Synonym(s): Insulin Chain B Oxidized from bovine pancreas
Empirical Formula (Hill Notation): C157H232N40O47S2
CAS No.:
30003-72-6
Molecular Weight:
3495.89
CompareProduct No.DescriptionSDSPricing
I6154vial of 10 nmol
All Photos(4)

Empirical Formula (Hill Notation): C153H225N43O49S
CAS No.:
16941-32-5
Molecular Weight:
3482.75
All Photos(1)

Exendin-4

Empirical Formula (Hill Notation): C184H282N50O60S
CAS No.:
141758-74-9
Molecular Weight:
4186.57
CompareProduct No.DescriptionSDSPricing
E7144≥97%
All Photos(1)

SNX-482

Synonym(s): SNX-482
Empirical Formula (Hill Notation): C192H274N52O60S7
CAS No.:
203460-30-4
Molecular Weight:
4495.00
CompareProduct No.DescriptionSDSPricing
5.08512
All Photos(1)

SNX-482 Recombinant

Synonym(s): GVDKAGCRYMFGGCSVNDDCCPRLGCHSLFSYCAWDLTFSD
Empirical Formula (Hill Notation): C192H274N52O60S7
CAS No.:
203460-30-4
Molecular Weight:
4495.00
CompareProduct No.DescriptionSDSPricing
SML1150≥98% (HPLC)
All Photos(1)

Proinsulin C-Peptide (55-89) human

Synonym(s): Proinsulin connecting peptide
Empirical Formula (Hill Notation): C153H259N49O52
CAS No.:
11097-48-6
Molecular Weight:
3616.99
CompareProduct No.DescriptionSDSPricing
C4999bioactive peptide hormone
All Photos(1)

Synonym(s): Neuropeptide Y, Human, NPY, hNPY
Empirical Formula (Hill Notation): C189H285N55O57S
CAS No.:
90880-35-6
Molecular Weight:
4271.68
All Photos(1)

Adrenocorticotropic Hormone human

Synonym(s): Adrenocorticotropic hormone fragment 1-39, Corticotropin A
Empirical Formula (Hill Notation): C207H308N56O58S
CAS No.:
12279-41-3
Molecular Weight:
4541.07
CompareProduct No.DescriptionSDSPricing
A0423≥97% (HPLC)
All Photos(1)

Cecropin A

Empirical Formula (Hill Notation): C184H313N53O46
CAS No.:
80451-04-3
Molecular Weight:
4003.78
CompareProduct No.DescriptionSDSPricing
C6830≥97% (HPLC), powder
All Photos(1)

Synonym(s): Parathyroid Hormone Fragment 1-34 human, PTH 1-34, Parathormone (1-34)
Empirical Formula (Hill Notation): C181H291N55O51S2
CAS No.:
52232-67-4
Molecular Weight:
4117.72
All Photos(1)

Chlorotoxin from Leiurus quinquestriatus (north Africa)

Empirical Formula (Hill Notation): C158H256N52O48S11
CAS No.:
163515-35-3
Molecular Weight:
4004.76
All Photos(1)

Pramlintide acetate salt

Synonym(s): 25,28,29 TriPro-amylin (human) acetate, AC 0137, AC 137, AC0137, AC137, TriPro-amylin acetate, [Pro25,28,29]-amylin (human) acetate
Empirical Formula (Hill Notation): C171H267N51O53S2
CAS No.:
187887-46-3
Molecular Weight:
3949.39
CompareProduct No.DescriptionSDSPricing
SML2523≥95% (HPLC)
All Photos(1)

Charybdotoxin

Empirical Formula (Hill Notation): C176H277N57O55S7
CAS No.:
95751-30-7
Molecular Weight:
4295.89
CompareProduct No.DescriptionSDSPricing
C7802≥90% (HPLC)
All Photos(1)

Calcitonin Gene Related Peptide human

Synonym(s): α-CGRP, CGRP-I
Empirical Formula (Hill Notation): C163H267N51O49S2
CAS No.:
90954-53-3
Molecular Weight:
3789.31
CompareProduct No.DescriptionSDSPricing
C0167≥95% (HPLC), powder
All Photos(1)

bis-MPA-Acetylene dendrimer

Empirical Formula (Hill Notation): C279H326O138
Molecular Weight:
5887.49
CompareProduct No.DescriptionSDSPricing
806153trimethylol propane core, generation 3
All Photos(1)

Cecropin B

Empirical Formula (Hill Notation): C176H301N51O42S
CAS No.:
80451-05-4
Molecular Weight:
3835.65
CompareProduct No.DescriptionSDSPricing
C1796≥97% (HPLC), powder
All Photos(1)

Glucagon-Like Peptide I human

Synonym(s): GLP-1, Preproglucagon 72-108
Empirical Formula (Hill Notation): C186H275N51O59
CAS No.:
87805-34-3
Molecular Weight:
4169.48
CompareProduct No.DescriptionSDSPricing
G3265≥97% (HPLC)
All Photos(1)

Parathyroid Hormone 1-34, Human

Synonym(s): Parathyroid Hormone 1-34, Human
Empirical Formula (Hill Notation): C181H291N55O51S2
CAS No.:
52232-67-4
Molecular Weight:
4117.72
All Photos(1)

Parathyroid Hormone Fragment 1-34 human

Synonym(s): PTH 1-34, Parathormone (1-34)
Empirical Formula (Hill Notation): C181H291N55O51S2
CAS No.:
52232-67-4
Molecular Weight:
4117.72
CompareProduct No.DescriptionSDSPricing
P3796≥95% (HPLC), powder
All Photos(1)

Copeptin trifluoroacetate human

Synonym(s): H-Ala-Ser-Asp-Arg-Ser-Asn-Ala-Thr-Gln-Leu-Asp-Gly-Pro-Ala-Gly-Ala-Leu-Leu-Leu-Arg-Leu-Val-Gln-Leu-Ala-Gly-Ala-Pro-Glu-Pro-Phe-Glu-Pro-Ala-Gln-Pro-Asp-Ala-Tyr-OH trifluoroacetate
Empirical Formula (Hill Notation): C177H279N49O58 · xC2HF3O2
CAS No.:
78362-34-2
Molecular Weight:
4021.40 (free base basis)
CompareProduct No.DescriptionSDSPricing
C8749≥95% (HPLC)
All Photos(1)

Diabetes Associated Peptide Amide human

Synonym(s): Amylin, DAP, IAPP, Insulinoma or Islet amyloid polypeptide
Empirical Formula (Hill Notation): C165H261N51O55S2
CAS No.:
122384-88-7
Molecular Weight:
3903.28
CompareProduct No.DescriptionSDSPricing
D2162≥97% (HPLC)
All Photos(1)

Urodilatin human

Synonym(s): Thr-Ala-Pro-Arg-Atrial Natriuretic Peptide
Empirical Formula (Hill Notation): C145H234N52O44S3
CAS No.:
115966-23-9
Molecular Weight:
3505.93
CompareProduct No.DescriptionSDSPricing
U5754≥97% (HPLC)
All Photos(1)

Teriparatide for system suitability

Synonym(s): Parathyroid Hormone Fragment 1-34 human, PTH 1-34, Parathormone (1-34)
Empirical Formula (Hill Notation): C181H291N55O51S2
CAS No.:
52232-67-4
Molecular Weight:
4117.72
CompareProduct No.DescriptionSDSPricing
Y0001895European Pharmacopoeia (EP) Reference Standard
All Photos(1)

rGlucagon, recombinant glucagon (human)

Synonym(s): Glucagon
Empirical Formula (Hill Notation): C153H225N43O49S
CAS No.:
16941-32-5
Molecular Weight:
3482.75
CompareProduct No.DescriptionSDSPricing
1294036United States Pharmacopeia (USP) Reference Standard
All Photos(1)

Iberiotoxin, Buthus tamulus, Recombinant, E. coli

Synonym(s): Iberiotoxin, Buthus tamulus, Recombinant, E. coli
CAS No.:
129203-60-7
CompareProduct No.DescriptionSDSPricing
401002
Page 1 of 2