MilliporeSigma
Search Within
Shipping
Product Category
Brand
Sustainability
Biological Source
Color
Feature
Formula Weight
Gene Alias
Melting Point (°C)
Physical Form
Product Line
Purity
Format
Quality Segment
Application
Reference Material Type
Special Grade
Technique
Available for Sale

231-212-3

Applied Filters:
Keyword:'231-212-3'
Showing 1-30 of 51 results for "231-212-3" within Products
All Photos(2)

Lithium chloride hydrate

Linear Formula: LiCl · xH2O
CAS No.:
85144-11-2
Molecular Weight:
42.39 (anhydrous basis)
EC No.:
231-212-3
CompareProduct No.DescriptionSDSPricing
298328≥99.99% trace metals basis
All Photos(1)

Empirical Formula (Hill Notation): C157H232N40O47S2
CAS No.:
30003-72-6
Molecular Weight:
3495.89
All Photos(1)

Glucagon, Human

Synonym(s): Glucagon, Human
Empirical Formula (Hill Notation): C153H225N43O49S
CAS No.:
9007-92-5
Molecular Weight:
3482.75
All Photos(1)

Astressin

Synonym(s): [D-Phe12, Nle21,38, Glu30, Lys33]-Corticotropin Releasing Factor fragment 12-41
Empirical Formula (Hill Notation): C161H269N49O42
CAS No.:
170809-51-5
Molecular Weight:
3563.16
CompareProduct No.DescriptionSDSPricing
A4933≥90% (HPLC)
All Photos(1)

Human glucagon

Synonym(s): Glucagon
Empirical Formula (Hill Notation): C153H225N43O49S
CAS No.:
9007-92-5
Molecular Weight:
3482.75
CompareProduct No.DescriptionPricing
Y0000191European Pharmacopoeia (EP) Reference Standard
All Photos(1)

Vasoactive Intestinal Peptide, Human, Porcine, and Rat

Synonym(s): Vasoactive Intestinal Peptide, Human, Porcine, and Rat
Empirical Formula (Hill Notation): C147H238N44O42S
CAS No.:
40077-57-4
Molecular Weight:
3325.80
All Photos(1)

Hyperbranched bis-MPA polyester-32-hydroxyl, generation 3

Synonym(s): ALH-32-OH, Hyperbranched Polymer, Hyperpolymer, PFH-32-OH
Empirical Formula (Hill Notation): C155H256O93
CAS No.:
326794-48-3
Molecular Weight:
3607.64
CompareProduct No.DescriptionSDSPricing
686581≥97%
All Photos(1)

ProteoMass Insulin chain B oxidized MALDI-MS Standard

Synonym(s): Insulin Chain B Oxidized from bovine pancreas
Empirical Formula (Hill Notation): C157H232N40O47S2
CAS No.:
30003-72-6
Molecular Weight:
3495.89
CompareProduct No.DescriptionSDSPricing
I6154vial of 10 nmol
All Photos(4)

Empirical Formula (Hill Notation): C153H225N43O49S
CAS No.:
16941-32-5
Molecular Weight:
3482.75
All Photos(1)

Exendin-4

Empirical Formula (Hill Notation): C184H282N50O60S
CAS No.:
141758-74-9
Molecular Weight:
4186.57
CompareProduct No.DescriptionSDSPricing
E7144≥97%
All Photos(1)

Defensin HNP-2 human

Synonym(s): Neutrophil Peptide-2
Empirical Formula (Hill Notation): C147H217N43O37S6
CAS No.:
99287-07-7
Molecular Weight:
3370.95
CompareProduct No.DescriptionSDSPricing
D6790≥95% (HPLC)
All Photos(1)

SNX-482

Synonym(s): SNX-482
Empirical Formula (Hill Notation): C192H274N52O60S7
CAS No.:
203460-30-4
Molecular Weight:
4495.00
CompareProduct No.DescriptionSDSPricing
5.08512
All Photos(1)

SNX-482 Recombinant

Synonym(s): GVDKAGCRYMFGGCSVNDDCCPRLGCHSLFSYCAWDLTFSD
Empirical Formula (Hill Notation): C192H274N52O60S7
CAS No.:
203460-30-4
Molecular Weight:
4495.00
CompareProduct No.DescriptionSDSPricing
SML1150≥98% (HPLC)
All Photos(1)

Exendin Fragment 9-39

Empirical Formula (Hill Notation): C149H234N40O47S
CAS No.:
133514-43-9
Molecular Weight:
3369.76
CompareProduct No.DescriptionSDSPricing
E7269≥95% (HPLC)
All Photos(1)

Glucagon-Like Peptide 1 Fragment 7-37 human

Synonym(s): GLP-1, 7-37, Preproglucagon 78-108
Empirical Formula (Hill Notation): C151H228N40O47
Molecular Weight:
3355.67
CompareProduct No.DescriptionSDSPricing
G9416≥96% (HPLC)
All Photos(1)

Synonym(s): Neuropeptide Y, Human, NPY, hNPY
Empirical Formula (Hill Notation): C189H285N55O57S
CAS No.:
90880-35-6
Molecular Weight:
4271.68
All Photos(1)

Adrenocorticotropic Hormone human

Synonym(s): Adrenocorticotropic hormone fragment 1-39, Corticotropin A
Empirical Formula (Hill Notation): C207H308N56O58S
CAS No.:
12279-41-3
Molecular Weight:
4541.07
CompareProduct No.DescriptionSDSPricing
A0423≥97% (HPLC)
All Photos(1)

Calcitonin human

Synonym(s): Calcitonin M, human C carcinoma, Calcitonin, human reduced cyclic (1→7)-disulfide, Thyrocalcitonin, hCT
Empirical Formula (Hill Notation): C151H226N40O45S3
CAS No.:
21215-62-3
Molecular Weight:
3417.85
EC No.:
244-276-2
CompareProduct No.DescriptionSDSPricing
T3535≥97% (HPLC), powder
All Photos(1)

Cecropin A

Empirical Formula (Hill Notation): C184H313N53O46
CAS No.:
80451-04-3
Molecular Weight:
4003.78
CompareProduct No.DescriptionSDSPricing
C6830≥97% (HPLC), powder
All Photos(1)

Synonym(s): Parathyroid Hormone Fragment 1-34 human, PTH 1-34, Parathormone (1-34)
Empirical Formula (Hill Notation): C181H291N55O51S2
CAS No.:
52232-67-4
Molecular Weight:
4117.72
All Photos(1)

Chlorotoxin from Leiurus quinquestriatus (north Africa)

Empirical Formula (Hill Notation): C158H256N52O48S11
CAS No.:
163515-35-3
Molecular Weight:
4004.76
All Photos(1)

Pramlintide acetate salt

Synonym(s): 25,28,29 TriPro-amylin (human) acetate, AC 0137, AC 137, AC0137, AC137, TriPro-amylin acetate, [Pro25,28,29]-amylin (human) acetate
Empirical Formula (Hill Notation): C171H267N51O53S2
CAS No.:
187887-46-3
Molecular Weight:
3949.39
CompareProduct No.DescriptionSDSPricing
SML2523≥95% (HPLC)
All Photos(1)

Charybdotoxin

Empirical Formula (Hill Notation): C176H277N57O55S7
CAS No.:
95751-30-7
Molecular Weight:
4295.89
CompareProduct No.DescriptionSDSPricing
C7802≥90% (HPLC)
All Photos(1)

Calcitonin Gene Related Peptide human

Synonym(s): α-CGRP, CGRP-I
Empirical Formula (Hill Notation): C163H267N51O49S2
CAS No.:
90954-53-3
Molecular Weight:
3789.31
CompareProduct No.DescriptionSDSPricing
C0167≥95% (HPLC), powder
All Photos(1)

bis-MPA-Acetylene dendrimer

Empirical Formula (Hill Notation): C279H326O138
Molecular Weight:
5887.49
CompareProduct No.DescriptionSDSPricing
806153trimethylol propane core, generation 3
All Photos(1)

Cecropin B

Empirical Formula (Hill Notation): C176H301N51O42S
CAS No.:
80451-05-4
Molecular Weight:
3835.65
CompareProduct No.DescriptionSDSPricing
C1796≥97% (HPLC), powder
All Photos(1)

Glucagon-Like Peptide I human

Synonym(s): GLP-1, Preproglucagon 72-108
Empirical Formula (Hill Notation): C186H275N51O59
CAS No.:
87805-34-3
Molecular Weight:
4169.48
CompareProduct No.DescriptionSDSPricing
G3265≥97% (HPLC)
All Photos(1)

Parathyroid Hormone 1-34, Human

Synonym(s): Parathyroid Hormone 1-34, Human
Empirical Formula (Hill Notation): C181H291N55O51S2
CAS No.:
52232-67-4
Molecular Weight:
4117.72
Page 1 of 2