Search Within
Document Type
302-95-4
Applied Filters:
Keyword:'302-95-4'
Showing 1-30 of 154 results for "302-95-4" within Technical Documents
Reboxetine mesylate-A selective norepinephrine reuptake inhibitor (SNRI)
V.E., J. Natl. Cancer Inst., 95, 292-302 (2003).
2. Vivanco, I. and Sawyers, C.L., Nat. Rev. Cancer, 2, 489-501 (2002).
3. Chun, K.H., et al., J. Natl. Cancer Inst., 95, 291-302 (2003).
O CH3
O
Product Information Sheet -LPLO001
and exposure of the cytoplasmic
surface by use of positively charged beads. Science, 195, 302, (1977).
4. Leifer, D., et al., Monoclonal antibody to Thy-1 enhances regeneration of processes by rat retinal
Product Information Sheet -LPLL001
and exposure of the cytoplasmic surface
by use of positively charged beads. Science, 195, 302, (1977).
4. Leifer, D., et al., Monoclonal antibody to Thy-1 enhances regeneration of processes by rat retinal
Product Information Sheet -LPDL001
and exposure of the cytoplasmic surface
by use of positively charged beads. Science, 195, 302, (1977).
4. Leifer, D., et al., Monoclonal antibody to Thy-1 enhances regeneration of processes by rat retinal
Data Sheet - A7603
., J. Antibiot., 30, 297-302 (1977).
2. Yamaguchi, H., et al., Microbiol. Immunol., 29, 609-
623 (1985).
3. Takeshima, H., et al., J. Biochem., 105, 606-610
(1989).
4. Osumi, M., Micron, 29, 207
QUALITY CONTROL RANGES - Milliplex Mouse CD8%26#43; T Cell Magnetic Bead Panel
GM-CSF Control 1 302 – 627 pg/mL IL-13 Control 1 519 – 1077 pg/mL
Control 2 2243 – 4658 pg/mL Control 2 4522 – 9392 pg/mL
Data Sheet - G9540
Sci. USA,
95, 1295-1300 (1998).
2. Saarma, M., and Sariola, H., Other neurotrophic
factors: glial cell line-derived neurotrophic factor
(GDNF)., Microdc. Res. Tech., 45, 292-302 (1999).
Product Information - P9172
electrophoresis.2 tRNA
(4 to 8 µg) complexed with Pyronin Y is visible as a
red band during electrophoresis. The stained tRNA is
also detectable by UV fluoresence at 302 nm.
Pyronin Y can also be
Data Sheet - P9172
according to Hassur.6 tRNA (4−8 µg) complexed with
Pyronin Y is visible as a red band during
electrophoresis. The stained tRNA can also be
detected using UV fluorescence at 302 nm.
1. Prepare a tRNA (
Data Sheet - SAB4200007
M., Curr. Drug Targets, 9, 565-570 (2008).
3. Semenov, M., and Snyder, M., Genomics, 42, 302-
310 (1997).
4. Lee, Y. et al., Cell Signal., 20, 443-452 (2008).
5. Li, L. et al., J.
Data Sheet - SAB4200008
M., Curr. Drug Targets, 9, 565-570 (2008).
3. Semenov, M., and Snyder, M., Genomics, 42, 302-
310 (1997).
4. Lee, Y. et al., Cell Signal., 20, 443-452 (2008).
5. Li, L. et al., J.
Data Sheet - D1321
M., Curr. Drug Targets, 9, 565-570 (2008).
3. Semenov, M., and Snyder, M., Genomics, 42, 302-
310 (1997).
4. Lee, Y. et al., Cell Signal., 20, 443-452 (2008).
5. Li, L. et al, J. Biol. Chem., 274
Data Sheet - I4517
Robb, R., et al., Proc. Natl. Acad. Sci. USA, 80,
5990 (1983).
10. Taniguchi, T., et al., Nature, 302, 305 (1983).
11. Coligan, J., et al., Current Protocols in Immu-
nology Vol. 1, 6:3.1 (1991).
Data Sheet - MSST0033
Experimental Station E268; 200
Powdermill Rd.; Wilmington, DE 19803; 1-877-881-
9787 (voice), 1-302-695-1437 (fax),
licensing@dupont.com.
JK,KR,MAM 09/16-1
mailto:licensing@
Data Sheet - MSST0019
DuPont Experimental Station E268; 200
Powdermill Rd.; Wilmington, DE 19803; 1-877-881-
9787 (voice), 1-302-695-1437 (fax),
licensing@dupont.com.
KR,AA,NA,AI,MAM 08/16-1
2016 Sigma-Aldrich
Data Sheet - MSST0015
Experimental Station E268; 200
Powdermill Rd.; Wilmington, DE 19803; 1-877-881-
9787 (voice), 1-302-695-1437 (fax),
licensing@dupont.com.
KR,MAM 02/17-1
mailto:licensing@dupont.com
Data Sheet - MSST0005
Identity: Confirmed by peptide mapping
Purity: 95% (SDS-PAGE)
Heavy amino acid incorporation efficiency: 98% (MS)
UniProt: P15692-4
Sequence Information
APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIF
Data Sheet - D1196
M., Curr. Drug Targets, 9, 565-570 (2008).
3. Semenov, M., and Snyder, M., Genomics, 42, 302-
310 (1997).
4. Lee, Y. et al., Cell Signal., 20, 443-452 (2008).
5. Li, L. et al, J. Biol. Chem., 274
Data Sheet - MSST0049
DuPont Experimental Station E268; 200
Powdermill Rd.; Wilmington, DE 19803; 1-877-881-
9787 (voice), 1-302-695-1437 (fax),
licensing@dupont.com.
SILu is a trademark of Sigma-Aldrich Co. LLC.
FLAG is
Data Sheet - MSST0043
Experimental Station E268; 200
Powdermill Rd.; Wilmington, DE 19803; 1-877-881-
9787 (voice), 1-302-695-1437 (fax),
licensing@dupont.com.
NA,JK,KR,MAM 12/16-1
2016 Sigma-Aldrich
Data Sheet - MSST0017
Experimental Station E268; 200
Powdermill Rd.; Wilmington, DE 19803; 1-877-881-
9787 (voice), 1-302-695-1437 (fax),
licensing@dupont.com.
KR,MAM 02/17-1
mailto:licensing@dupont.com
Data Sheet - MSST0031
Experimental Station E268; 200
Powdermill Rd.; Wilmington, DE 19803; 1-877-881-
9787 (voice), 1-302-695-1437 (fax),
licensing@dupont.com.
JK,KR,MAM,CY 09/21-1
mailto:licensing
Data Sheet - SRP9001
Biophys., 302, 484-489 (1993).
3. Gearing, D.P. et al., Molecular cloning and
expression of cDNA encoding a murine myeloid
leukemia inhibitory factor (LIF). EMBO J., 6, 3995-
4002 (1987).
4. Lord
Data Sheet - MSST0039
Experimental Station E268; 200
Powdermill Rd.; Wilmington, DE 19803; 1-877-881-
9787 (voice), 1-302-695-1437 (fax),
licensing@dupont.com.
RD,JK,KR,MAM 02/22-1
mailto:licensing
Data Sheet - MSST0037
Experimental Station E268; 200
Powdermill Rd.; Wilmington, DE 19803; 1-877-881-
9787 (voice), 1-302-695-1437 (fax),
licensing@dupont.com.
JK,KR,MAM 10/16-1
mailto:licensing@
Data Sheet - MSST0051
DuPont Experimental Station E268; 200
Powdermill Rd.; Wilmington, DE 19803; 1-877-881-
9787 (voice), 1-302-695-1437 (fax),
licensing@dupont.com.
SILu is a trademark of Sigma-Aldrich Co. LLC.
FLAG is a
Data Sheet - MSST0057
DuPont Experimental Station E268; 200
Powdermill Rd.; Wilmington, DE 19803; 1-877-881-
9787 (voice), 1-302-695-1437 (fax),
licensing@dupont.com.
SILu is a trademark of Sigma-Aldrich Co. LLC.
NA,MAM
Data Sheet - MSST0007
Experimental Station E268; 200
Powdermill Rd.; Wilmington, DE 19803; 1-877-881-
9787 (voice), 1-302-695-1437 (fax),
licensing@dupont.com.
KR,NA,MAM 08/16-1
mailto:licensing@dupont.com
Data Sheet - MSST0053
DuPont Experimental Station E268; 200
Powdermill Rd.; Wilmington, DE 19803; 1-877-881-
9787 (voice), 1-302-695-1437 (fax),
licensing@dupont.com.
SILu is a trademark of Sigma-Aldrich Co. LLC.
FLAG is a
Data Sheet - MSST0041
Experimental Station E268; 200
Powdermill Rd.; Wilmington, DE 19803; 1-877-881-
9787 (voice), 1-302-695-1437 (fax),
licensing@dupont.com.
JK,KR,MAM 10/16-1
mailto:licensing@
Page 1 of 6