Skip to Content
MilliporeSigma
Search Within
Document Type

76-25-5

Applied Filters:
Keyword:'76-25-5'
Showing 1-30 of 896 results for "76-25-5" within Technical Documents
Data Sheet - S4569
peptide Lane 5 immunogen 4. After preincubation membranes were incubated with 0.50 µg/mL SLP-76 [pTyr145] antibody for two hours at room temperature in a 3% BSA-TBST buffer. 5. After washing
J14 Human SLP-76-Deficient Jurkat Cell Line
that lacks expression of SLP-76 (SH2 domain–containing leukocyte protein of 76 kilodaltons), an adaptor protein and PTK substrate expressed in hematopoietic cells.2 SLP-76 together with the scaffolding
NovAseptic® Valve Actuator/Diaphragm Installation Guide
26-29Lbft 0m m 0m m NA 51/90 NA 76/90 0m m NA 51/90 NA 76/90 2 www.emdmillipore.com 5 6 7 4 3 8
Data Sheet - F8551
is produced from a DNA sequence encoding the mature 76 amino acid variant of the chemokine domain of mature rat fractalkine (amino acid residues 25 to 100, QHLGMTKCNITCHKMTSPIPVTLLIHYQLNQESCGKR AIILETRQHRHFCADPKEKWVQDAMKHLDHQTAALTR
The Effective Use of Protein Kinase Inhibitors
92 4 5 5 29 23 5 113 124 104 105 80 83 62 90 85 97 69 110 40 96 106 98 96 72 71 79 93 106 56 103 13 5 2 62 39 19 92
SMC®Plate Washer Evaluation Kit
68 53 69 63 68 62 58 59 64 61 60 81 64 7 11 F 76 63 73 83 73 70 83 65 70 84 66 87 74 8 11 G 78 62 55 44 68 51
The Effective Use of Protein Kinase Inhibitors
92 4 5 5 29 23 5 113 124 104 105 80 83 62 90 85 97 69 110 40 96 106 98 96 72 71 79 93 106 56 103 13 5 2 62 39 19 92
Product Information Sheet-11336045001
190 147 124 110 67 37 34 26 19 https://www.sigmaaldrich.com 08 21 .1 13 52 76 80 01 20 3. Results y Version: 20
Solvent Resistant Stirred Cells for Ultrafiltration and Filtration Applications
Qty. 14 mm 25 mm 44.5 mm 63.5 mm 76 mm 90 mm 150 mm Ultracel Amicon® Ultrafiltration Discs, Regenerated Cellulose YM1 1,000 NMWL 100 40422 10 13312 13322 13332 13342 5 13351 13361
Product Information Sheet - C1139
100 ml CH3OH) D6016 14110-71-5 White powder C29H37NO5 481.64 192-193°C C2149 36011-19-5 White powder C28H33NO7 495.58 206°C -25.6 (1g/100 ml MeOH @ 25°C) C8273 22144-76-9 White powder or white powder
Product Information Sheet - C0138
100 ml CH3OH) D6016 14110-71-5 White powder C29H37NO5 481.64 192-193°C C2149 36011-19-5 White powder C28H33NO7 495.58 206°C -25.6 (1g/100 ml MeOH @ 25°C) C8273 22144-76-9 White powder or white powder
Salts for analysis EMSURE®
1.01145.1000 5 kg Plastic bottle 1.01145.5000 25 kg Fibre carton 1.01145.9025 50 kg Fibre carton 1.01145.9050 Ammonium dihydrogen phosphate for analysis EMSURE® ACS, Reag. Ph Eur 7722-76-1 (NH
Data Sheet - 62634
fäkalcoliforme Bakterien im Rahmen der hygienischen Überprüfung von Badegewässer gemäss der EG-Richtlinie 76/160 EWG, Zbl. Hyg., 191, 438 (1991) 3. Bundesgesundheitsamt: Amtliche Sammlung von Untersuchungsverfahren
Data Sheet - E0643
al., Human erythropoietin receptor: cloning, expression, and biologic characterization. Blood, 76, 31-35 (1990). 2. Constantinescu, S.N., et al., The Erythropoietin Receptor: Structure, Activation
Molecular Biology Reagents Insert: OmniPur®
4870 500 g 5 kg 25 kg 50 kg $33 $209 $1070 $1552 OmniPur® L-Histidine 5450 5 kg $2,921.00 N-Acetyl-L(+)-cysteine AX0206/1 25 g $92.00 L-Aspartic Acid B37022/44 5 kg
Spare parts for Mobius®Bioreactors (50 L, 200 L, 1000 L & 2000 L)
Only 52 86 1 5 76 50 97 96 87 94 95 76 2 84 78 79 51 3 80 82 4
User Guide (IFU) - R03087
Harleco IFU Page 1 of 4 R03087-76 Microscopy Leishman Stain
Product Information Sheet - 739316
Fax +32 (0)3 444 76 62 Mobile +32 (0) 484 56 04 80 e-mail: bavo.muys@agfa.com FRANK LOUWET General Product Manager Tel. +32 (0)3 444 32 50 Fax +32 (0)3 444 76 62 Mobile
Product Information Sheet - O8801
and H.E. French. J. Am. Chem. Soc., 40, 424 (1918). 5• Y. Mikshich and Z. Pinterovich, Bull Soc. Chem. Roy Yugoslav., 1, 9 (1930); Chem. Abstr., 25, 4246 (1931). 6• L. Lesser and G. Gad, Ber., 60B
Series 8000 Stirred Cells and Ultrafiltration Membranes
Minimum Process Volume: 0.075 mL 1.0 mL 2.5 mL 5.0 mL 10.0 mL Nominal Membrane Diameter: 25 mm 25 mm 43 mm 62 mm 76 mm Effective Membrane Area: 0.9 cm 4.1 cm 13.4 cm 28.7 cm 41.8 cm Hold-up Volume:* 0.07
Data Sheet - E4644
al., Human erythropoietin receptor: cloning, expression, and biologic characterization. Blood, 76, 31-35 (1990). 2. Constantinescu, S.N., et al., The Erythropoietin Receptor: Structure, Activation
Product Information Sheet - C3784
C8H15NO4 Molecular Weight: 189.2 CAS Number: 79831-76-8 Melting Point: 212-215 °C (with decomposition)1 Specific Rotation: +79.7° (9.3 mg/ml, H2O, 25 °C)1 pKa: 6.09 1 Synonyms: [1S-(1α,6β,7α,8β
Steripak-GP Pressure Driven Filter Unit
size: 99 mm (3.88 in.) 76 mm (3 in.) 100 cm2 0.22 µm 99 mm (3.88 in.) 76 mm (3 in.) 200 cm2 0.22 µm Filtration Volume 10 L 20 L
Product Information Sheet - I5879
Biochem. Biophys. Res. Commun., 59(1), 386-391 (1974). 9. Russell, T.R., Proc. Natl. Acad. Sci. USA, 76(9), 4451-4454 (1979). 10. Janik, P. et al., Cancer Res., 40(6), 1950-1954 (1980). 11. Sustarsic
Product Information Sheet - 80476
temp 66 68 70 72 74 76 78 80 82 84 86 88 90 92 94 96 98 100 10 11
Data Sheet - C7740
Horwitz, J., Exp. Eye Res., 76, 145-153 (2003). 3. Bhat, S.P., Prog. Drug Res., 60, 205-262 (2003). 4. Narberhaus, F., Microbiol. Mol. Biol. Rev., 66, 64- 93 (2002). 5. Van Rijk, A.F. and Bloemendal
Data Sheet - 31404
to virus and inhibit initial adsorption to susceptible cells. 25 References: 1. Rankin, J.C. and Jeanes, A., J. Am. Chem. Soc., 76, 4435 (1954). 2. Dimler, R.J. et al., J. Am. Chem. Soc., 77, 6568
Data Sheet - 22092
sterilisation. 5 to 10 ml of blood may be added to 50 ml of medium. Cultural characteristics after 18-48 hours at 35ºC (if necessary 76 hours). Growth max. incubation time in days 3 3
Product Information Sheet - T1647
Molecular Formula: C2HF3O2 Molecular Weight: 114.0 CAS Number: 76-05-1 pKa: 0.3; 1 0.23 (water at 25 °C)2; 0.50 (water at 25 °C)3 Melting Point: -15.4 °C 1 Boiling Point: 72.4 °C;1 70.5-72
Page 1 of 30