Skip to Content
MilliporeSigma
All Photos(2)

Key Documents

AV37145

Sigma-Aldrich

Anti-SREBF1 (AB1) antibody produced in rabbit

affinity isolated antibody

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

125 kDa

species reactivity

mouse, human

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

mouse ... SREBF1(20787)

General description

Sterol regulatory element-binding protein 1 (SREBP1) is a member of the basic helix-loop-helix (bHLH) family of transcription factors.

Immunogen

Synthetic peptide directed towards the N terminal region of mouse SREBF1

Biochem/physiol Actions

Sterol regulatory element-binding protein 1 (SREBP1) regulates de novo lipogenesis. It can be used as a biomarker and a therapeutic target due to its function as an oncogene and a pro-proliferation factor in thyroid cancer. It bind to a sequence in the promoter of different genes, called sterol regulatory element-1 (SRE1). Upon cleavage of the precursor form of the protein, SREBF1 gets translated into the nucleus where it induces transcription of genes involved in glucose metabolism and fatty acid and lipid production. Sterols block cleavage of the precursor protein inhibiting transcription.
Sterol regulatory element-binding transcription factor 1 (SREBF1) binds to a sequence in the promoter of different genes, called sterol regulatory element-1 (SRE1). Upon cleavage of the precursor form of the protein, SREBF1 gets translated into the nucleus where it induces transcription of genes involved in glucose metabolism and fatty acid and lipid production. Sterols block cleavage of the precursor protein inhibiting transcription.

Sequence

Synthetic peptide located within the following region: DIEDMLQLINNQDSDFPGLFDAPYAGGETGDTGPSSPGANSPESFSSASL

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 2

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Cuilin Li et al.
Biomedicine & pharmacotherapy = Biomedecine & pharmacotherapie, 123, 109791-109791 (2019-12-31)
SREBP1 is a well-known transcript factor regulating lipogenesis. It has been reported to play an important role in tumor progress in recent years. However, the roles of SREBP1 in differentiated thyroid cancer (DTC) are uncertain. Based on this, we aimed
Delphine Eberlé et al.
Biochimie, 86(11), 839-848 (2004-12-14)
Sterol regulatory element binding proteins (SREBPs) are a family of transcription factors that regulate lipid homeostasis by controlling the expression of a range of enzymes required for endogenous cholesterol, fatty acid (FA), triacylglycerol and phospholipid synthesis. The three SREBP isoforms
Enrique M Toledo et al.
Cell reports, 31(5), 107601-107601 (2020-05-07)
Liver X receptors (LXRs) and their ligands are potent regulators of midbrain dopaminergic (mDA) neurogenesis and differentiation. However, the molecular mechanisms by which LXRs control these functions remain to be elucidated. Here, we perform a combined transcriptome and chromatin immunoprecipitation

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service