AV40182

Anti-HOMER1 (AB2) antibody produced in rabbit

affinity isolated antibody

• Synonym(s): Anti-HOMER1A, Anti-HOMER1B, Anti-HOMER1C, Anti-Homer homolog 1 (Drosophila), Anti-SYN47, Anti-Ves-1
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 39 kDa
• species reactivity: pig, rabbit, human, rat, dog, horse, bovine, mouse
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• NCBI accession no.: NP_004263
• UniProt accession no.: Q86YM7
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... HOMER1(9456)

Description

General description

Homer proteins are cytoplasmic adaptor proteins that contain the Ena/VASP homology 1 domain that binds to the PPXXF sequence motifs found in Ca²⁺ handling proteins such as IP3 receptors, transient receptor potential canonical (TRPC) channels and ryanodine receptor (RyR) Ca²⁺ release channels. HOMER1, a calcium signaling complex modulator, is involved in the opening and closing of TRPC channels such as the endoplasmic reticulum store-operated Ca²⁺ -influx channels (SOCs). Homer1 plays a critical role in determining the apoptotic susceptibility to TRAIL, an apoptotic cell death-inducing ligand that belongs to a TNF superfamily.

Specificity

Anti-HOMER1 (AB2) polclonal antibody reacts with canine, human, mouse, rat, and bovine homer 1 adaptor proteins.

Immunogen

Synthetic peptide directed towards the N terminal region of human HOMER1

Application

Anti-HOMER1 (AB2) polclonal antibody is used to tag the homer 1 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of homer 1 as a modulator of calcium transport and signaling involved in apoptosis, body movement and various cellular processes.

Biochem/physiol Actions

HOMER1 is a member of the homer family of dendritic proteins. Members of this family regulate group 1 metabotrophic glutamate receptor function.This gene encodes a member of the homer family of dendritic proteins. Members of this family regulate group 1 metabotrophic glutamate receptor function.This gene encodes a member of the homer family of dendritic proteins. Members of this family regulate group 1 metabotrophic glutamate receptor function.

Sequence

Synthetic peptide located within the following region: EKFQEFKEAARLAKEKSQEKMELTSTPSQESAGGDLQSPLTPESINGTDD

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable