Skip to Content
MilliporeSigma
All Photos(2)

Key Documents

AV54779

Sigma-Aldrich

Anti-LGALS3BP antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-90K, Anti-Lectin, galactoside-binding, soluble, 3 binding protein, Anti-MAC-2-BP

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

63 kDa

species reactivity

human, mouse

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... LGALS3BP(3959)

Immunogen

Synthetic peptide directed towards the middle region of human LGALS3BP

Application

Anti-LGALS3BP antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.

Biochem/physiol Actions

LGALS3BP (Lectin, galactoside-binding, soluble, 3 binding protein) or MAC-2-BP gene encodes a Galectin-3-binding protein localized to chromosome 17q25. It is widely expressed by keratinocytes and fibroblasts but is also present in fluids like- semen, milk, serum, tears, saliva and urine. LGALS3BP stimulates the intergrin-mediated cell adhesion. It also imposes stimulatory impact on host defense system like natural killer (NK) and lymphokine-activated killer (LAK) cell cytotoxicity. Furthermore, the encoded protein interacts specifically with galectin-1 and galectin-3 and facilitates the formation of multicell aggregates.

Sequence

Synthetic peptide located within the following region: NLSLYWSHEALFQKKTLQALEFHTVPFQLLARYKGLNLTEDTYKPRIYTS

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

A Ullrich et al.
The Journal of biological chemistry, 269(28), 18401-18407 (1994-07-15)
Immunization of mice with conditioned media from human breast cancer cells yielded the monoclonal antibody SP-2, which recognized an antigen of approximately 90-95 kDa. This protein, designated 90K, was found to be present in the serum of healthy individuals and
N Tinari et al.
International journal of cancer, 91(2), 167-172 (2001-01-09)
The glycoprotein 90K was originally described as a tumor-secreted antigen and subsequently found to have immunostimulatory activity as well as other possible functions. This protein interacts with an endogenous lectin, galectin-3, and may play a role in tumor metastasis through
K Koths et al.
The Journal of biological chemistry, 268(19), 14245-14249 (1993-07-05)
We have purified and sequenced a secreted glycoprotein from both the human breast carcinoma cell line, SK-BR-3, and human breast milk. The native protein binds specifically to a human macrophage-associated lectin known as Mac-2. This Mac-2 binding protein (Mac-2-BP) has

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service