Skip to Content
Merck
All Photos(2)

Key Documents

HPA015022

Sigma-Aldrich

Anti-ORAI3 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-Protein orai-3, Anti-Transmembrane protein 142C

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200

immunogen sequence

APLDTPTPMVPTSRVPGTLAPVATSLSPASNLPRSSASAAPSQAEPACPPRQACGGGGAHGPGWQA

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... ORAI3(93129)

General description

ORAI3 (ORAI calcium release-activated calcium modulator 3) is one of the three isoforms of the highly selective Ca2+ channel called ORAI. This isoform is exclusive to mammals. It contains an ORAI domain in its N-terminal, which is completely conserved. This protein, along with ORAI1, makes the arachidonate-regulated Ca2+ (ARC) channel, which is store-independent.

Immunogen

Protein orai-3 recombinant protein epitope signature tag (PrEST)

Application

Anti-ORAI3 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Biochem/physiol Actions

ORAI3 (ORAI calcium release-activated calcium modulator 3) is a key member of the Ca2+ release-activated Ca2+ (CRAC) pathway, which is the predominant pathway to allow the entry of Ca2+ into the cell. This channel is activated when it either interacts with STIM1, or in the presence of 2-aminoethoxydiphenyl borate (2-APB). It is up-regulated in breast cancer cells, and in MCF-7 BC cell line it promotes cell cycle, cell growth and survival. It also regulates c-myc proto-oncogene, though the MAP kinase pathway. This channel is also controlled by estrogen receptor (ER)α, and in ERα+ breast cancer, it activates store-operated Ca2+ entry (SOCE), and facilitates tumorigenesis. In non-small cell lung adenocarcinoma, it might activate Akt pathway, which is responsible for cell proliferation and cell cycle progression.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST73073

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Anne-Sophie Ay et al.
PloS one, 8(9), e72889-e72889 (2013-09-24)
Orai channels have been associated with cell proliferation, survival and metastasis in several cancers. The present study investigates the expression and the role of Orai3 in cell proliferation in non-small cell lung cancer (NSCLC). We show that Orai3 is over-expressed
Rajender K Motiani et al.
FASEB journal : official publication of the Federation of American Societies for Experimental Biology, 27(1), 63-75 (2012-09-21)
Store-operated Ca(2+) entry (SOCE) encoded by Orai1 proteins is a ubiquitous Ca(2+)-selective conductance involved in cellular proliferation and migration. We recently described up-regulation of Orai3 channels that selectively mediate SOCE in estrogen receptor α-expressing (ERα(+)) breast cancer cells. However, the
Malika Faouzi et al.
Biochimica et biophysica acta, 1833(3), 752-760 (2012-12-26)
Members of the Orai family are highly selective calcium ion channels that play an important role in store-operated calcium entry. Among the three known Orai isoforms, Orai3 has gained increased attention, notably for its emerging role in cancer. We recently
Estella Zuccolo et al.
Oncotarget, 9(57), 31098-31119 (2018-08-21)
Store-operated Ca2+ entry (SOCE) provides a major Ca2+ entry route in cancer cells. SOCE is mediated by the assembly of Stim and Orai proteins at endoplasmic reticulum (ER)-plasma membrane junctions upon depletion of the ER Ca2+ store. Additionally, Stim and
Judith Bergsmann et al.
The Journal of biological chemistry, 286(36), 31565-31575 (2011-07-05)
STIM1 and Orai represent the key components of Ca(2+) release-activated Ca(2+) channels. Activation of Orai channels requires coupling of the C terminus of STIM1 to the N and C termini of Orai. Although the latter appears to be central in

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service