HPA051516
Anti-MAN1B1 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Synonym(s):
Anti-MANA-ER, Anti-MRT15
Sign Into View Organizational & Contract Pricing
All Photos(1)
About This Item
Recommended Products
biological source
rabbit
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
product line
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
technique(s)
immunohistochemistry: 1:50- 1:200
immunogen sequence
METGLSPEIVHFNLYPQPGRRDVEVKPADRHNLLRPETVESLFYLYRVTGDRKYQDWGWEILQSFSRFTRVPSGGYSSINNVQDPQKP
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... MAN1B1(11253)
General description
Mannosidase alpha class 1B member 1 (MAN1B1), also called endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase, is a 79.5 kDa type II membrane protein. It has a cytoplasmic tail, transmembrane domain, middle stem region and a large catalytic domain at the C-terminus.(1) MAN1B1 gene has 13 exons and is mapped to human chromosome 9q34.3.
Immunogen
mannosidase, alpha, class 1B, member 1 recombinant protein epitope signature tag (PrEST)
Application
All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Biochem/physiol Actions
Mannosidase alpha class 1B member 1 (MAN1B1) catalyses the removal of mannose residues during N-glycan biosynthesis. It is part of endoplasmic reticulum associated degradation (ERAD) of glycoproteins. It is also part of the endoplasmic reticulum (ER) quality control machinery. Mutation in MAN1B1 is implicated in nonsyndromic autosomal-recessive intellectual disability disorder. Deficiency of MAN1B1 impacts N-glycosylation and is associated with congenital disorders of glycosylation (CDG). MAN1B1 is highly expressed in bladder cancer and silencing of its expression impacts the cancer progression, making MAN1B1 a potential drug target.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Linkage
Corresponding Antigen APREST85733
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.
Legal Information
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
10 - Combustible liquids
WGK
WGK 1
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Certificates of Analysis (COA)
Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
MAN1B1 mutation leads to a recognizable phenotype: a case report and future prospects
Hoffjan S, et al.
Molecular Syndromology, 6(2), 58-62 (2015)
Mutations in the alpha 1, 2-mannosidase gene, MAN1B1, cause autosomal-recessive intellectual disability
Rafiq MA, et al.
American Journal of Human Genetics, 89(1), 176-182 (2011)
MAN1B1 is associated with poor prognosis and modulates proliferation and apoptosis in bladder cancer
Wang HF, et al.
Gene, 679(12), 314-319 (2018)
Mammalian ER mannosidase I resides in quality control vesicles, where it encounters its glycoprotein substrates
Benyair R, et al.
Molecular Biology of the Cell, 26(2), 172-184 (2015)
MAN1B1 deficiency: an unexpected CDG-II
Rymen D, et al.
PLoS Genetics, 9(12), e1003989-e1003989 (2013)
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service