SAB1402681

Monoclonal Anti-ACP5 antibody produced in mouse

clone 2D9, purified immunoglobulin, buffered aqueous solution

• Synonym(s): MGC117378, TRAP
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: mouse
• Quality Level: 100
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 2D9, monoclonal
• form: buffered aqueous solution
• mol wt: antigen ~35.68 kDa
• species reactivity: human
• technique(s): capture ELISA: suitable; immunofluorescence: suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• isotype: IgG2aκ
• NCBI accession no.: BC025414
• UniProt accession no.: P13686
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... ACP5(54)

Description

General description

This gene encodes an iron containing glycoprotein which catalyzes the conversion of orthophosphoric monoester to alcohol and orthophosphate. It is the most basic of the acid phosphatases and is the only form not inhibited by L(+)-tartrate. (provided by RefSeq)

Immunogen

ACP5 (AAH25414.1, 72 a.a. ~ 158 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
NFYFTGVQDINDKRFQETFEDVFSDRSLRKVPWYVLAGNHDHLGNVSAQIAYSKISKRWNFPSPFYRLHFKIPQTNVSVAIFMLDTV

Physical form

Solution in phosphate buffered saline, pH 7.4

Safety Information

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable