WH0004103M1

Monoclonal Anti-MAGEA4 antibody produced in mouse

clone 3D12, purified immunoglobulin, buffered aqueous solution

• Synonym(s): Anti-MAGE4, Anti-MAGE41, Anti-MAGE4A, Anti-MAGE4B, Anti-MAGEX2, Anti-MGC21336, Anti-melanoma antigen family A, 4
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: mouse
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 3D12, monoclonal
• form: buffered aqueous solution
• species reactivity: mouse
• technique(s): indirect ELISA: suitable; indirect immunofluorescence: suitable; western blot: 1-5 μg/mL
• isotype: IgG2bκ
• GenBank accession no.: NM_002362
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... MAGEA4(4103)

Description

General description

MAGEA4 (Melanoma antigen family A 4) is a member of Cancer testis antigens (CTAs) family Class I and is expressed in only male germ cells. It is identified by cytolytic T lymphocytes (CTL) and is upregulated in a variety of tumor cells such as melanomas and lung cancer.

Immunogen

MAGEA4 (NP_002353, 98 a.a. ~ 171 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
TSPDAESLFREALSNKVDELAHFLLRKYRAKELVTKAEMLERVIKNYKRCFPVIFGKASESLKMIFGIDVKEVD

Biochem/physiol Actions

MAGEA4 (Melanoma antigen family A 4) induces growth in spontaneously transformed normal oral keratinocytes (NOK-SI) by blocking cell cycle at G1 phase as well as p53 mediated apoptosis. Studies have shown it to tumor suppressive in nature. Studies in 160 chronic HCV (hepatitis C virus) Egyptian patients egyptian patients show that this protein has potential as a marker for early detectiont of metastases.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class Code: 10 - Combustible liquids
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable
• Personal Protective Equipment: dust mask type N95 (US), Eyeshields, Gloves