Skip to Content
Merck
All Photos(2)

Key Documents

AV38763

Sigma-Aldrich

Anti-POU4F1 antibody produced in rabbit

IgG fraction of antiserum

Synonym(s):

Anti-POU domain, class 4, transcription factor 1

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

43 kDa

species reactivity

guinea pig, rat, human, mouse, rabbit

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... POU4F1(5457)

Immunogen

Synthetic peptide directed towards the C terminal region of human POU4F1

Biochem/physiol Actions

POU4F1 is a neural transcription factor that is involved in the development of sensory nervous system. POU domain factors are characterized by the DNA-binding POU domain that is highly conserved. These factors bind to DNA and regulate transcription by protein-protein interactions. POU domain factors are critical regulators of early embryogenesis, development of mammalian forebrain, development and function of neuroendocrine system, regulation of gene expression in pituitary gland and hypothalamus.

Sequence

Synthetic peptide located within the following region: LEAYFAVQPRPSSEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRMKFSATY

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Min Zou et al.
Developmental biology, 364(2), 114-127 (2012-02-14)
The sensory neurons of the dorsal root ganglia (DRG) must project accurately to their central targets to convey proprioceptive, nociceptive and mechanoreceptive information to the spinal cord. How these different sensory modalities and central connectivities are specified and coordinated still
B Andersen et al.
Endocrine reviews, 22(1), 2-35 (2001-02-13)
POU domain factors are transcriptional regulators characterized by a highly conserved DNA-binding domain referred to as the POU domain. The structure of the POU domain has been solved, facilitating the understanding of how these proteins bind to DNA and regulate
POU-domain transcription factors: pou-er-ful developmental regulators.
M G Rosenfeld
Genes & development, 5(6), 897-907 (1991-06-01)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service