Skip to Content
Merck
All Photos(9)

Key Documents

AMAB91067

Sigma-Aldrich

Monoclonal Anti-MOG antibody produced in mouse

Prestige Antibodies® Powered by Atlas Antibodies, clone CL2858, purified immunoglobulin, buffered aqueous glycerol solution

Synonym(s):

BTN6

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

biological source

mouse

Quality Level

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

CL2858, monoclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

rat, mouse, human

technique(s)

immunoblotting: 1 μg/mL
immunohistochemistry: 1:2500- 1:5000

isotype

IgG1

immunogen sequence

ALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAMELKVEDPFYWVSPG

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... MOG(4340)

General description

Myelin oligodendrocyte glycoprotein (MOG) is usually present at the extracellular surface of myelin sheaths and oligodendrocytes in the central nervous system. The human MOG gene is located 60 kilobases (kb) telomeric to HLA-F (major histocompatibility complex, class I, F) in a head-to-head orientation. This gene is mapped to human chromosome 6p22.1.

Immunogen

myelin oligodendrocyte glycoprotein

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

Myelin oligodendrocyte glycoprotein (MOG) is highly required for maternal embryogenesis. It plays a crucial role in the perpetuation of MS (multiple sclerosis). In animals, MOG acts as a target autoantigen in demyelinating diseases like autoimmune encephalomyelitis (EAE).

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST84510

Physical form

40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

More mog genes that influence the switch from spermatogenesis to oogenesis in the hermaphrodite germ line of Caenorhabditis elegans..
Graham PL, et al.
Developmental Genetics, 14(6), 471-484 (1993)
Antibodies to myelin oligodendrocyte glycoprotein in idiopathic optic neuritis.
Nakajima H, et al.
BMJ Open, 5(4), e007766-e007766 (2015)
Physical mapping of the human and mouse MOG gene at the distal end of the MHC class Ib region.
Pham-Dinh D, et al.
Immunogenetics, 42(5), 386-391 (1995)
The discoidin domain receptor 1 as a novel susceptibility gene for schizophrenia.
Roig B, et al.
Molecular Psychiatry, 12(9), 833-833 (2007)
Immune modulation by a tolerogenic myelin oligodendrocyte glycoprotein (MOG) 10?60 containing fusion protein in the marmoset experimental autoimmune encephalomyelitis model.
Kap YS, et al.
Clinical and Experimental Immunology, 180(1), 28-39 (2015)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service