Skip to Content
Merck
All Photos(2)

Key Documents

AV02055

Sigma-Aldrich

Anti-TP53 antibody produced in rabbit

IgG fraction of antiserum

Synonym(s):

Anti-Tumor protein p53 (Li-Fraumeni syndrome)

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

44 kDa

species reactivity

human

concentration

0.5 mg - 1 mg/mL

technique(s)

immunohistochemistry: suitable
western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... TP53(7157)

Immunogen

Synthetic peptide directed towards the C terminal region of human TP53

Application

Anti-TP53 antibody produced in rabbit is suitable for western blotting at a concentration of 1 μg/ml.
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Western Blotting (1 paper)

Biochem/physiol Actions

TP53 is a tumor suppressor protein essential for protection against development of cancer. Mutations in the TP53 gene or alterations in function of the protein result in predisposition to colorectal cancer, gastric and esophageal cancers. TP53 also acts as a transcription factor and maintains the genetic stability preventing malignant transformation.

Sequence

Synthetic peptide located within the following region: RELNEALELKDAQAGKEPGGSRAHSSHLKSKKGQSTSRHKKLMFKTEGPD

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Marilanda Ferreira Bellini et al.
Journal of biomedicine & biotechnology, 2012, 891961-891961 (2012-08-25)
TP53 genes is one of more important tumor suppressor gene, which acts as a potent transcription factor with fundamental role in the maintenance of genetic stability. The development of esophageal and gastric cancers is a multistep process resulting in successive
A Naccarati et al.
Mutagenesis, 27(2), 211-218 (2012-02-02)
A functionally normal TP53 is essential to protect organisms from developing cancer. Somatic mutations in the gene represent one of the highest recurring perturbations in human tumours, including colorectal cancer (CRC). However, the variegated phenotype of wide spectrum of somatic
Shingo Miyawaki et al.
Nature communications, 7, 11471-11471 (2016-05-11)
The naked mole-rat (NMR, Heterocephalus glaber), which is the longest-lived rodent species, exhibits extraordinary resistance to cancer. Here we report that NMR somatic cells exhibit a unique tumour-suppressor response to reprogramming induction. In this study, we generate NMR-induced pluripotent stem

Articles

p53 regulates gene expression, cell cycle control and functions as a tumor suppressor. Inactivation of p53 is closely tied to cancer development.

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service