Skip to Content
Merck
All Photos(4)

Key Documents

SAB2100200

Sigma-Aldrich

Anti-BACE1 antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-β-Site APP-cleaving enzyme 1, Anti-ASP2, Anti-BACE, Anti-FLJ90568, Anti-HSPC104

Sign Into View Organizational & Contract Pricing


About This Item

MDL number:
UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

51 kDa

species reactivity

rabbit, bovine, guinea pig, mouse, rat, horse, dog, human

concentration

0.5 mg - 1 mg/mL

technique(s)

immunofluorescence: suitable
immunohistochemistry: suitable
western blot: suitable

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... BACE1(23621)

General description

β-site APP cleaving enzyme (BACE-1) is known as β-secretase. It consists of an N-terminal signal peptide (SP), a pro-peptide (Pro) domain, a catalytic domain, a transmembrane domain and a C-terminal tail.
BACE1, a member of the peptidase A1 protein family, is a type I integral membrane glycoprotein and aspartic protease that is found mainly in the Golgi.

Immunogen

Synthetic peptide directed towards the N terminal region of human BACE1

Biochem/physiol Actions

β-site APP cleaving enzyme (BACE-1) acts as a rate-limiting enzyme of amyloid-β-peptide (Aβ). Overexpression of BACE-1 leads to increased β-secretase activity.

Sequence

Synthetic peptide located within the following region: GQGYYVEMTVGSPPQTLNILVDTGSSNFAVGAAPHPFLHRYYQRQLSSTY

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

pHluorin-BACE1-mCherry Acts as a Reporter for the Intracellular Distribution of Active BACE1 In Vitro and In Vivo
Zhao L, et al.
Cells, 8(5), 474-474 (2019)
Proteolytic processing of Neuregulin-1
Willem M
Brain Research Bulletin, 126(5), 178-182 (2016)
beta-Site APP cleaving enzyme up-regulation induced by 4-hydroxynonenal is mediated by stress-activated protein kinases pathways
Tamagno E, et al.
Journal of Neurochemistry, 92(3), 628-636 (2005)
Chang Qu et al.
Journal of advanced research, 35, 231-243 (2022-01-14)
Honokiol (HO) exerts neuroprotective effects in several animal models of Alzheimer's disease (AD), but the poor dissolution hampers its bioavailability and therapeutic efficacy. A novel honokiol nanoscale drug delivery system (Nano-HO) with smaller size and excellent stability was developed in
Edward T Parkin et al.
PloS one, 17(1), e0255715-e0255715 (2022-01-14)
The amyloid cascade hypothesis proposes that excessive accumulation of amyloid beta-peptides is the initiating event in Alzheimer's disease. These neurotoxic peptides are generated from the amyloid precursor protein via sequential cleavage by β- and γ-secretases in the 'amyloidogenic' proteolytic pathway.

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service