WH0005325M1

Monoclonal Anti-PLAGL1 antibody produced in mouse

clone 1E2, ascites fluid

• Synonym(s): Anti-DKFZp781P1017, Anti-LOT1, Anti-ZAC, Anti-ZAC1, Anti-pleiomorphic adenoma gene-like 1
• UNSPSC Code: 12352203
• NACRES: NA.43

Properties

• biological source: mouse
• Quality Level: 100
• conjugate: unconjugated
• antibody form: ascites fluid
• antibody product type: primary antibodies
• clone: 1E2, monoclonal
• species reactivity: human
• technique(s): indirect ELISA: suitable; western blot: 1:500-1:1000
• isotype: IgMκ
• GenBank accession no.: NM_002656
• UniProt accession no.: Q9UM63
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... PLAGL1(5325)

Description

General description

This gene encodes a C2H2 zinc finger protein with transactivation and DNA-binding activity. This gene has been shown to exhibit antiproliferative activities and is a tumor suppressor gene candidate. Many transcript variants encoding two different isoforms have been found for this gene. (provided by RefSeq)

Immunogen

PLAGL1 (NP_002647.2, 221 a.a. ~ 320 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
QPMQPLPESLASLHPSVSPGSPPPPLPNHKYNTTSTSYSPLASLPLKADTKGFCNISLFEDLPLQEPQSPQKLNPGFDLAKGNAGKVNLPKELPADAVNL

Biochem/physiol Actions

The maternally-imprinted gene, PLAGL1 (pleiomorphic adenoma-like protein 1), functions as an oncogene as well as a tumor suppressor depending on the cell context. It has been found to exhibit anti-proliferative properties and regulate apoptosis and cell-cycle arrest via p53.

Physical form

Solution

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Safety Information

• Storage Class Code: 10 - Combustible liquids
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable
• Personal Protective Equipment: dust mask type N95 (US), Eyeshields, Gloves