Skip to Content
Merck
All Photos(11)

Key Documents

Safety Information

HPA005993

Sigma-Aldrich

Anti-UCHL1 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-Neuron cytoplasmic protein 95, Anti-PGP 95, Anti-PGP9.5, Anti-UCH-L1, Anti-Ubiquitin carboxyl-terminal hydrolase isozyme L1, Anti-Ubiquitin thioesterase L1

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

mouse, human, rat

enhanced validation

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:2500-1:5000

immunogen sequence

QEVSPKVYFMKQTIGNSCGTIGLIHAVANNQDKLGFEDGSVLKQFLSETEKMSPEDRAKCFEKNEAIQAAHDAVAQEGQCRVDDKVNFHFILFNNVDGHLYELDGRMPFPVNHGASSEDTLLKDAAKVCREFTEREQGEVRFSAVAL

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... UCHL1(7345)

General description

The ubiquitin C-terminal hydrolase L1 (UCH-L1) gene is mapped to human chromosome 4p13. The protein localized in the cytosol and nucleus. UCH-L1 protein is primarily expressed in neuroendocrine tissues, neurons and in testis/ovary. Rabbit polyclonal anti-UCHL1 antibody recognizes ubiquitin carboxyl-terminal hydrolase isozyme L1.

Immunogen

Ubiquitin carboxyl-terminal hydrolase isozyme L1 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Anti-UCHL1 antibody produced in rabbit has been used in:
  • immunohistochemistry at 1:100 dilution
  • immunofluorescence
  • proximity ligation assay
  • indirect immunolabeling at 1:1000 dilution

Biochem/physiol Actions

Ubiquitin C-terminal hydrolase-L1 (UCHL1) is a deubiquitinating enzyme (DUB) that hydrolyzes C-terminal ubiquitin esters and amides, and peptide−ubiquitin amides to ubiquitin monomers in- vitro. In addition to DUB activity, it also possesses E3 ubiquitin-protein ligase activity. UCHL1 is involved in the regulation of the ubiquitin-dependent proteolytic system. UCH-L1 plays a vital role in cancer development and progression by upstream activation of protein kinase B (Akt). Mutation in the UCHL1 gene is associated with the development of Parkinson′s disease (PD).

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST86224

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Regulatory Listings

Regulatory Listings are mainly provided for chemical products. Only limited information can be provided here for non-chemical products. No entry means none of the components are listed. It is the user’s obligation to ensure the safe and legal use of the product.

JAN Code

HPA005993-25UL:
HPA005993-100UL:


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

H J Kim et al.
Oncogene, 28(1), 117-127 (2008-09-30)
Ubiquitin C-terminal hydrolase-L1 (UCH-L1) catalyses the hydrolysis of ubiquitin ester and amide mainly in neuronal cells. Recently it was proposed as a marker with a potential role in carcinogenesis. However, the molecular mechanism underlying the biological function of UCH-L1 in
Honghong Yang et al.
International journal of clinical and experimental pathology, 8(11), 13957-13967 (2016-01-30)
Gastric cardiac adenocarcinoma (GCA) accounts for a majority of gastric cancer population and harbors unfavorable outcome. Ubiquitin C-terminal hydrolase L1 (UCH-L1) belongs to the deubiquitinating enzyme family, which could regulate cell growth in human cancers. In the present study, expression
Yan Jin et al.
International journal of clinical and experimental pathology, 10(11), 10802-10811 (2017-11-01)
UCH-L1 has been implicated to playing a potential role in cancer development and progression. However, UCH-L1's role in hilar cholangiocarcinoma remains unclear. The function of UCH-L1 in hilar cholangiocarcinoma was evaluated using human tissues, molecular and cell biology, and animal
Ryota Nakashima et al.
Scientific reports, 7(1), 6879-6879 (2017-08-02)
Hypoxia-inducible factor 1 (HIF-1) has been recognized as an important mediator of the reprogramming of carbohydrate metabolic pathways from oxidative phosphorylation to accelerated glycolysis. Although this reprogramming has been associated with the antioxidant and radioresistant properties of cancer cells, gene
Neuroglial cells in long-term primary cultures from the gilthead seabream (Sparus aurata L.): new functional in vitro model from bony fish brain
Centoducati G, et al.
Italian Journal of Animal Science, 12(1), e5-e5 (2013)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service