Skip to Content
Merck
All Photos(7)

Key Documents

Safety Information

WH0003170M1

Sigma-Aldrich

Monoclonal Anti-FOXA2 antibody produced in mouse

clone 7E6, purified immunoglobulin, buffered aqueous solution

Synonym(s):

Anti-HNF3B, Anti-MGC19807, Anti-TCF3B, Anti-forkhead box A2

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41
conjugate:
unconjugated
application:
ELISA (i)
IF
IP
WB
clone:
7E6, monoclonal
species reactivity:
human
citations:
5
technique(s):
immunoprecipitation (IP): suitable
indirect ELISA: suitable
indirect immunofluorescence: suitable
western blot: 1-5 μg/mL

biological source

mouse

Quality Level

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

7E6, monoclonal

form

buffered aqueous solution

species reactivity

human

technique(s)

immunoprecipitation (IP): suitable
indirect ELISA: suitable
indirect immunofluorescence: suitable
western blot: 1-5 μg/mL

isotype

IgG2aκ

GenBank accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... FOXA2(3170)

General description

This gene encodes a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific genes such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver. This gene has been linked to sporadic cases of maturity-onset diabetes of the young. Transcript variants encoding different isoforms have been identified for this gene. (provided by RefSeq)

Immunogen

FOXA2 (NP_068556, 363 a.a. ~ 457 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
HLKPEHHYAFNHPFSINNLMSSEQQHHHSHHHHQPHKMDLKAYEQVMHYPGYGSPMPGSLAMGPVTNKTGLDASPLAADTSYYQGVYSRPIMNSS

Biochem/physiol Actions

Forkhead box A2 (FOXA2) expressed in the liver, pancreas, intestine, and lungs, is associated with embryonic formation of the primitive streak and endoderm. It also plays an important role in airway epithelial differentiation and is extensively expressed in type II pneumocytes. Decreased expression of Foxa2 is observed in lung cancer and non-small-cell lung cancer (NSCLC). FOXA2 plays a vital role in normal pancreatic β-cell function, therefore, aberration in the expression of the gene leads to hyperinsulinemic hypoglycemia. FOXA2 also has an essential role in pancreatic α-cell differentiation. FOXA2 expressed along with FOXA1 in the foregut endoderm plays a vital role in liver, hepatic and neuronal development, these factors also have an overlapping role in lung morphogenesis. FOXA2 acts a regulator of the network of gene associated with the intestinal epithelial cell function. Increased expression of FOXA2 in MKN-45 cells (human gastric cancer cell line) elevates E-cadherin expression and inhibits gastric cancer cell migration and invasion and therefore, FOXA2 is expressed at low levels in gastric adenocarcinoma tissues.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Regulatory Listings

Regulatory Listings are mainly provided for chemical products. Only limited information can be provided here for non-chemical products. No entry means none of the components are listed. It is the user’s obligation to ensure the safe and legal use of the product.

JAN Code

WH0003170M1-100UG:


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Zhengliang Zhang et al.
Xi bao yu fen zi mian yi xue za zhi = Chinese journal of cellular and molecular immunology, 31(5), 672-676 (2015-05-06)
To investigate the expression of FOXA2 in human gastric adenocarcinoma and its correlation with cell migration and invasion. Fifty-six pairs of gastric adenocarcinoma and matched tumor-adjacent tissues were freshly collected. The expressions of FOXA2 and epithelial cadherin (E-cadherin) in the
Daniela S Basseres et al.
Lung cancer (Amsterdam, Netherlands), 77(1), 31-37 (2012-02-22)
We sought to determine the mechanisms of downregulation of the airway transcription factor Foxa2 in lung cancer and the expression status of Foxa2 in non-small-cell lung cancer (NSCLC). A series of 25 lung cancer cell lines were evaluated for Foxa2
Catherine S Lee et al.
Developmental biology, 278(2), 484-495 (2005-02-01)
The differentiation of insulin-producing beta-cells has been investigated in great detail; however, little is known about the factors that delineate the second-most abundant endocrine lineage, the glucagon-producing alpha-cell. Here we utilize a novel YAC-based Foxa3Cre transgene to delete the winged
Nehal Gosalia et al.
Physiological genomics, 47(7), 290-297 (2015-04-30)
The forkhead box A (FOXA) family of pioneer transcription factors is critical for the development of many endoderm-derived tissues. Their importance in regulating biological processes in the lung and liver is extensively characterized, though much less is known about their
Genes Involved in DNA Repair and Mitophagy Protect Embryoid Bodies from the Toxic Effect of Methylmercury Chloride under Physioxia Conditions.
Augustyniak, et al.
Cells, 12 (2023)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service