HPA000288
Anti-ACE2 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Synonym(s):
Anti-ACE-related carboxypeptidase antibody produced in rabbit, Anti-ACEH antibody produced in rabbit, Anti-Angiotensin-converting enzyme 2 precursor antibody produced in rabbit, Anti-Angiotensin-converting enzyme homolog antibody produced in rabbit
Sign Into View Organizational & Contract Pricing
All Photos(6)
About This Item
Recommended Products
biological source
rabbit
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
product line
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
enhanced validation
orthogonal RNAseq
Learn more about Antibody Enhanced Validation
technique(s)
immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:500-1:1000
immunogen sequence
MSSSSWLLLSLVAVTAAQSTIEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQNGSSVLSED
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... ACE2(59272)
General description
Angiotensin-converting enzyme 2 (ACE2) is mapped to human chromosome Xp22.2. It is a homolog of ACE and shares 42% sequence identity. ACE2 is expressed in kidney, gastrointestinal and cardiovascular tissues.
Angiotensin-converting enzyme-2 (ACE2) is a homolog of angiotensin-I converting enzyme (ACE). ACE2 is a member of the renin-angiotensin system (RAS) which performs functions similar to carboxypeptidase. This 805 amino acid protein is localized in human kidney. The ACE2 gene is located at human chromosome Xp22.2. It contains a N-terminal peptidase domain (PD) and the C-terminal collectrin-like domain (CLD).
Immunogen
Angiotensin-converting enzyme 2 precursor recombinant protein epitope signature tag (PrEST)
Application
All Prestige Antibodies®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Anti-ACE2 antibody produced in rabbit has been used for immunohistochemistry at a dilution of 1:500-1:1000. It has also been used in western blotting at a working concentration of 0.04-0.4 μg/ml.
Biochem/physiol Actions
Angiotensin-converting enzyme (ACE2) catalyzes the degradation of angiotensin (Ang) II to Ang (1-7). The deficiency ACE2 or its inhibition by ang II is implicated in the pathogenesis of cardiac hypertrophy and myocardial dysfunction. ACE2 is multifunctional and is incapable of hydrolyzing bradykinin. In patients with CTD (connective tissue disease), serum autoantibodies suppress ACE2, which leads to a decrease in the physiological levels of vasoprotective agent Ang (1-7) in the vascular milieu. Activation or administration of ACE2 in patients with CTD may serve as a therapeutic method for treating pulmonary arterial hypertension (PAH), or persistent digital ischemia. It also plays a regulatory role in lung diseases and pulmonary fibrosis. The human ACE2 receptor is recognized by severe acute respiratory syndrome (SARS-CoV) coronaviruses (CoVs) 2. This interaction paves a way for the transmission of infection.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Linkage
Corresponding Antigen APREST74018
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Legal Information
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
10 - Combustible liquids
WGK
WGK 1
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Personal Protective Equipment
dust mask type N95 (US), Eyeshields, Gloves
Certificates of Analysis (COA)
Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Customers Also Viewed
Jiewen Fu et al.
Molecular biology reports, 47(6), 4383-4392 (2020-05-16)
The ACE2 gene is a receptor of SARS-CoV-2 (severe acute respiratory syndrome coronavirus 2) for COVID-19 (coronavirus disease 2019). To analyze the expression profiles and clinical significances for this gene in humans, RNA-seq data representing 27 different tissues were analyzed
Laale F Alawi et al.
Physiological reports, 8(3), e14364-e14364 (2020-02-07)
Alteration in renin-angiotensin system (RAS) has been implicated in the pathophysiology of diabetic kidney disease (DKD). The deleterious actions of angiotensin II (Ang II) could be antagonized by the formation of Ang-(1-7), generated by the actions of angiotensin-converting enzyme 2
Keiji Kuba et al.
Current opinion in pharmacology, 6(3), 271-276 (2006-04-04)
The renin-angiotensin system (RAS) plays a key role in maintaining blood pressure homeostasis, as well as fluid and salt balance. Angiotensin II, a key effector peptide of the system, causes vasoconstriction and exerts multiple biological functions. Angiotensin-converting enzyme (ACE) plays
Robert V Blair et al.
The American journal of pathology, 191(2), 274-282 (2020-11-11)
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) induces a wide range of disease severity, ranging from asymptomatic infection to a life-threating illness, particularly in the elderly population and individuals with comorbid conditions. Among individuals with serious coronavirus 2019 (COVID-19) disease
Laale F Alawi et al.
Frontiers in pharmacology, 11, 602985-602985 (2021-03-13)
Activation of the renin angiotensin system plays a pivotal role in the regulation of blood pressure, which is mainly attributed to the formation of angiotensin-II (Ang II). The actions of Ang II are mediated through binding to the Ang-II type
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service