Skip to Content
MilliporeSigma
Get up to 22% off for Pi Day until 3/26.Save Now

MSST0008

SILuLite CLU Clusterin human

recombinant, expressed in HEK 293 cells, MS Protein Standard

Synonym(s):

Apolipoprotein J, Clusterin, Testosterone-repressed prostate message 2 (TRPM-2)

Sign In to View Organizational & Contract Pricing.

Select a Size


About This Item

NACRES:
NA.12
UNSPSC Code:
23201100
Form:
lyophilized powder
Assay:
≥98% (SDS-PAGE)
Biological source:
human
Recombinant:
expressed in HEK 293 cells
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

human

recombinant

expressed in HEK 293 cells

assay

≥98% (SDS-PAGE)

form

lyophilized powder

technique(s)

mass spectrometry (MS): suitable

suitability

suitable for mass spectrometry (internal calibrator)

UniProt accession no.

storage temp.

−20°C

Quality Level

Gene Information

human ... CLU(1191)

Related Categories

General description

SILuLite Clusterin is a recombinant human protein expressed in human 293 cells. It is a heterodimer of 2 subunits (alpha and beta) consisting of 427 amino acids (including N-terminal polyhistidine and V5 tags), with a calculated molecular weight of 50 kDa. SILuLite Clusterin is designed to be used as an internal standard for bioanalysis of Clusterin in mass-spectrometry.

Biochem/physiol Actions

Clusterin is a secreted glycosylated, 80-kDa disulfide-linked heterodimer of alpha and beta subunits (produced by internal cleavage). Clusterin is expressed in virtually all tissues and found in all human fluids. It is involved in numerous physiological processes important for carcinogenesis and tumor growth, including anti-apoptotic cell survival, cell cycle regulation, cell adhesion, tissue remodeling and lipid transportation. Clusterin also exists as a nuclear protein. The secreted form of Clusterin has extracellular chaperone and anti-apoptotic activities while the nuclear form acts as a proapoptotic factor.

Physical form

Supplied as a lyophilized powder containing phosphate buffered saline.

Other Notes

DQTVSDNELQEMSNQGSKYVNKEIQNAVNGVKQIKTLIEKTNEERKTLLSNLEEAKKKKEDALNETRESETKLKELPGVCNETMMALWEECKPCLKQTCMKFYARVCRSGSGLVGRQLEEFLNQSSPFYFWMNGDRIDSLLENDRQQTHMLDVMQDHFSRASSIIDELFQDRFFTREPQDTYHYLPFSLPHRRPHFFFPKSRIVRSLMPFSPYEPLNFHAMFQPFLEMIHEAQQAMDIHFHSPAFQHPPTEFIREGDDDRTVCREIRHNSTGCLRMKDQCDKCREILSVDCSTNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQWKMLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLRVTTVASHTSDSDVPSGVTEVVVKLFDSDPITVTVPVEVSRKNPKFMETVAEKALQEYRKKHREESDPSRGPFEGKPIPNPLLGLDSTRTGHHHHHHHHGGQ

Legal Information

This product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), licensing@dupont.com.
SILu is a trademark of Sigma-Aldrich Co. LLC

Storage Class

11 - Combustible Solids

wgk

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Related Content

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service