WH0003576M5

Monoclonal Anti-IL8 antibody produced in mouse

clone 6G4, purified immunoglobulin, buffered aqueous solution

• Synonym(s): Anti-CXCL8, Anti-GCP1, Anti-Interleukin 8, Anti-K60, Anti-NAP1, Anti-SCYB8, Anti-TSG1
• MDL number: MFCD00212220
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: mouse
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 6G4, monoclonal
• form: buffered aqueous solution
• species reactivity: human
• technique(s): indirect ELISA: suitable; western blot: 1-5 μg/mL
• isotype: IgG2aκ
• GenBank accession no.: BC013615.1
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... IL8(3576)

Description

General description

Interleukin-8 (IL-8)/CXCL8 is an important chemoattractant cytokine and activator of neutrophils. It is liberated from endothelial cells, gingival fibroblasts, neutrophils, monocytes and phagocytes in the gingival crevice. IL-8 belongs to the CXC subfamily. This gene is located on human chromosome 4q13.3.

The protein encoded by this gene is a member of the CXC chemokine family. This chemokine is one of the major mediators of the inflammatory response. This chemokine is secreted by several cell types. It functions as a chemoattractant, and is also a potent angiogenic factor. This gene is believed to play a role in the pathogenesis of bronchiolitis, a common respiratory tract disease caused by viral infection. This gene and other ten members of the CXC chemokine gene family form a chemokine gene cluster in a region mapped to chromosome 4q. (provided by RefSeq)

Immunogen

IL8 (AAH13615.1, 21 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
EGAVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS

Biochem/physiol Actions

Interleukin-8 (IL-8) chemoattracts and activates neutrophils. It is involved in guiding neutrophils and oligodendrocytes to sites of infection. The protein also stimulates angiogenesis and tumor growth. It is also associated with inflammatory diseases.

Interleukin-8 (IL-8)/CXCL8 participates in the progression of peripheral muscle weakness in individuals with COPD (chronic obstructive pulmonary disease). It helps in the transport of neutrophils across endothelium, pulmonary epithelium and fibroblasts. CXCL8 induces adhesion of neutrophils to extracellular matrix proteins and cytokine-stimulated endothelial monolayers via interaction with CD11b/CD18 (β2-integrins).

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class Code: 10 - Combustible liquids
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable
• Personal Protective Equipment: dust mask type N95 (US), Eyeshields, Gloves