콘텐츠로 건너뛰기
Merck
모든 사진(4)

문서

MSQC3

Sigma-Aldrich

SILuMAB Stable-Isotope Labeled Universal Monoclonal Antibody Standard human

recombinant, expressed in CHO cells

동의어(들):

Mass spectrometry standard, IgG, Mass spectrometry standard, Immunoglobulin-G, Stable isotope labelled IgG

로그인조직 및 계약 가격 보기


About This Item

UNSPSC 코드:
23201100
NACRES:
NA.12

재조합

expressed in CHO cells

Quality Level

분석

≥90% (SDS-PAGE)

포장

vial of 100 μg (± 10% Lot-specific vial content given on certificate of analysis)

배송 상태

wet ice

저장 온도

−20°C

유사한 제품을 찾으십니까? 방문 제품 비교 안내

관련 카테고리

일반 설명

SILuMab is a recombinant, stable isotope-labeled, human monoclonal antibody which incorporates [13C6, 15N4]-Arginine and [13C6, 15N2]-Lysine. Expressed in CHO cells, SILuMab is designed to be used as a universal internal standard for bioanalysis of monoclonal antibodies. Because of overlap with common sequences in the Fc region with candidate antibodies, SILuMab provides universal utility and thus eliminates the need to produce candidate-specific internal standards. SILuMab is an IgG1 antibody with lambda light chain, but contains peptide sequences common to other IgG isotypes.

애플리케이션

SILuMAB Stable-Isotope Labeled Universal Monoclonal Antibody Standard human has been used in a comparative study of automated antibody de novo sequencing.

특징 및 장점

Universal Peptide SequenceLocation
DTLMISRHeavy Chain (IgG1, IgG2, IgG3, IgG4)
FNWYVDGVEVHNAKHeavy Chain (IgG1)
VVSVLTVLHQDWLNGKHeavy Chain (IgG1, IgG3, IgG4)
NQVSLTCLVKHeavy Chain (IgG1, IgG2, IgG3, IgG4)
GFYPSDIAVEWESNGQPENNYKHeavy Chain (IgG1, IgG4)
AGVETTTPSKLight Chain (lambda)
YAASSYLSLTPEQWKLight Chain (lambda)
SILuMab has been validated as an internal standard for quantitation of relevant biotherapeutics in a complex biological matrix by MRM-based LC-MS/MS.
  • SILuMab yielded reproducible, linear curves from 0.1 μg/mL to 1000 μg/mL without enrichment or depletion.
  • Good agreement was observed between multiple peptides derived from the same target.
  • Label incorporation was determined to be >98% by mass spectrometry.
  • Sequence coverage was confirmed by peptide mapping.

물리적 형태

Supplied as a lyophilized powder containing phosphate buffered saline

제조 메모

Produced utilizing enriched media containing stable isotope labeled amino acids are 13C6, 15N4-labeled arginine and 13C6, 15N2-labeled lysine
SILuMab design is optimized to be used as an internal standard for quantitation of monoclonal antibodies as well as Fc-fusion therapeutics. Because of overlap with the common sequences in the Fc region with candidate antibodies, SILuMab provides univer­sal utility, thus eliminating the need for production of candidate-specific internal standards.

재구성

SILuMab recovery is maximized when 0.1% formic acid is used for reconstitution of the lyophilized product. Reconstitution with other solvents may reduce recovery. Do not freeze after reconstitution.
Procedure
  • Briefly centrifuge the vial at ~10,000 x g to collect the product at the bottom of the vial.
  • Add 500 μL of purified water containing 0.1% formic acid to the vial.
  • Mix the contents by gently inverting the vial a minimum of 5 times.
  • Allow the vial to stand at room temperature for a minimum of 15 minutes and repeat mixing by inversion.

분석 메모

SILuMab Heavy Chain
EVQLVESGGGLVQPGGSLRLSCVASGFTLNNYDMHWVRQGIGKGLEWVSKI
GTAGDRYYAGSVKGRFTISRENAKDSLYLQMNSLRVGDAAVYYCARGAGRW
APLGAFDIWGQGTMVTVSS|ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYF
PEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVN
HKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISR
TPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRV
VSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPS
RDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFL
YSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG

SILuMab Light Chain
QSALTQPRSVSGSPGQSVTISCTGTSSDIGGYNFVSWYQQHPGKAPKLMIY
DATKRPSGVPDRFSGSKSGNTASLTISGLQAEDEADYYCCSYAGDYTPGV
VFGGGTKLTVL|GQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTV
AWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQ
VTHEGSTVEKTVAPTECS

Target overlap areas are underlined
Qualitative
Intact heavy and light chains (FASTA file)

Quantitative
MRM settings provided (Skyline, xls)
Package size based on protein content determined by A280 using an extinction coefficient (E0.1%) of 1.4

법적 정보

This product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), licensing@dupont.com.
SILu is a trademark of Sigma-Aldrich Co. LLC

Storage Class Code

11 - Combustible Solids

WGK

WGK 3

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable


시험 성적서(COA)

제품의 로트/배치 번호를 입력하여 시험 성적서(COA)을 검색하십시오. 로트 및 배치 번호는 제품 라벨에 있는 ‘로트’ 또는 ‘배치’라는 용어 뒤에서 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

Noritaka Hashii et al.
Bioanalysis, 12(4), 231-243 (2020-02-25)
Aim: A generic bioanalytical method was developed to quantify therapeutic IgG1 monoclonal antibodies (mAbs) in mouse sera by combining an easy sample preparation method with LC/MS using selected reaction monitoring. Materials & methods: Rituximab and trastuzumab were used as model
Qian Zhang et al.
Analytical chemistry, 86(17), 8776-8784 (2014-07-11)
Quantitation of therapeutic monoclonal antibodies (mAb) using liquid chromatography-tandem mass spectrometry (LC-MS/MS) for pharmacokinetic (PK) studies is becoming an essential complement to traditional antibody-based ligand binding assays (LBA). Here we show an automated method to perform LC-MS/MS-based quantitation, with IgG1
Sandor Schokker et al.
mAbs, 12(1), 1795492-1795492 (2020-08-04)
Given the increasing use of combination therapy with multiple monoclonal antibodies (mAbs), there is a clinical need for multiplexing assays. For the frequently co-administered anti-human epidermal growth factor receptor 2 (HER2) mAbs trastuzumab and pertuzumab, we developed a high-throughput and
K Ilker Sen et al.
Journal of the American Society for Mass Spectrometry, 28(5), 803-810 (2017-01-21)
Applications of antibody de novo sequencing in the biopharmaceutical industry range from the discovery of new antibody drug candidates to identifying reagents for research and determining the primary structure of innovator products for biosimilar development. When murine, phage display, or
Christina Boch et al.
Biomedicines, 10(9) (2022-09-24)
One important prerequisite for developing a therapeutic monoclonal antibody is to evaluate its in vivo efficacy. We tested the therapeutic potential of an anti-CD96 antibody alone or in combination with an anti-PD-1 antibody in a mouse colon cancer model. Early

관련 콘텐츠

Discover our wide variety of products for intact mass analysis of monoclonal antibodies, including size-exclusion columns (SEC), ion exchange columns, reverse-phase columns, HPLC buffers, MALDI matrices and standards, high-purity solvents, reagents, tools for protein sample preparation, and certified reference materials.

단클론 항체의 무손상 질량 분석을 위한 Merck의 다양한 제품에 대해 알아보세요. 크기 배제 컬럼(SEC, size-exclusion column), 이온 교환 컬럼, 역상 컬럼, HPLC 버퍼, MALDI 기질 및 표준 물질, 고순도 용매, 시약, 단백질 검체 준비용 기구, 공인 참조 물질 등이 있습니다.

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.