MilliporeSigma
All Photos(1)

Documents

MSQC11

Sigma-Aldrich

SILuMAb Adalimumab Stable-Isotope Labeled Monoclonal Antibody

Sign Into View Organizational & Contract Pricing

Synonym(s):
Mass spectrometry standard, Adalimumab, SIL Adalimumab, Stable isotope labelled Adalimumab

recombinant

expressed in CHO cells

Quality Level

antibody product type

primary antibodies

Assay

≥90% (SDS-PAGE)

packaging

vial of 100 μg

shipped in

wet ice

storage temp.

−20°C

Related Categories

Compare Similar Items

View Full Comparison

Show Differences

1 of 4

This Item
MSQC3MSQC25MSQC27
shipped in

wet ice

shipped in

wet ice

shipped in

wet ice

shipped in

wet ice

storage temp.

−20°C

storage temp.

−20°C

storage temp.

−20°C

storage temp.

−20°C

recombinant

expressed in CHO cells

recombinant

expressed in CHO cells

recombinant

expressed in CHO cells

recombinant

expressed in CHO cells

antibody product type

primary antibodies

antibody product type

-

antibody product type

-

antibody product type

-

assay

≥90% (SDS-PAGE)

assay

≥90% (SDS-PAGE)

assay

≥90% (HPLC)

assay

≥90% (HPLC)

Still not finding the right product?  

Give our Product Selector Tool a try.

General description

SILu MAb Adalimumab Stable-Isotope Labeled Monoclonal Antibody is a recombinant, stable isotope labeled, monoclonal antibody which incorporates [13C6, 15N4]-Arginine and [13C6, 15N2]-Lysine. Expressed in CHO cells, SILuMAb Adalimumab is designed to be used as an internal standard for analysis of Adalimumab in human serum. Each vial of SILuMAb Adalimumab contains the labeled antibody lyophilized from a solution of phosphate buffered saline. Vial content was determined by measuring A280 and using an extinction coefficient (E0.1%) of 1.4.
SILu MAb Adalimumab is for R&D use only. Not for drug, household, or other uses.

Immunogen

SILuMab Adalimumab Heavy Chain: EVQLVESGGGLVQPGRSLRLSCAASGFTFDDYAMHWVRQAPGKGLEWVSAITWNSGHIDYADSVEGR
FTISRDNAKNSLYLQMNSLRAEDTAVYYCAKVSYLSTASSLDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNS
GALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEV
TCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRD
ELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG

SILuMab Adalimumab Light Chain:
DIQMTQSPSSLSASVGDRVTITCRASQGIRNYLAWYQQKPGKAPKLLIYAASTLQSGVPSRFSGSGSGTDFTLTISSLQPEDVATYYCQRYNRAPYTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Sequence

Adalimumab-Specific Peptide Sequences Liberated from SILuMAb Adalimumab by Tryptic Digest

Universal Peptide Sequence Location
GLEWVSAITWNSGHIDYADSVEGRHeavy chain
APYTFGQGTKLight chain
FSGSGSGTDFTLTISSLQPEDVATYYCQRLight chain

Preparation Note

Produced utilizing enriched media containing stable isotope labeled amino acids are 13C6, 15N4-labeled Arginine and 13C6, 15N2-labeled Lysine.
SILuMab Adalimumab is designed to be used as a internal standard for analysis of Adalimumab in human serum.

Reconstitution

Each vial of SILuMab Adalimumab contains the labeled antibody in a lyophilized form containing phosphate buffered saline.
SILuMab Adalimumab recovery is maximized when 0.1% formic acid is used for reconstitution of the lyophilized product.Reconstitution with other solvents may reduce recovery. Do not freeze after reconstitution.

  • Briefly centrifuge the vial at ~10,000 × g to collect the product at the bottom of the vial.
  • Add 500 μL of ultrapure water containing 0.1% formic acid to the vial.
  • Mix the contents by gently inverting the vial a minimum of 5 times.
  • Allow the vial to stand at room temperature for at least 15 minutes and repeat mixing by inversion.

Analysis Note

Quantitative
MRM settings provided (xls)

Legal Information

This product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), licensing@dupont.com.
SILu is a trademark of Sigma-Aldrich Co. LLC

Storage Class Code

13 - Non Combustible Solids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Documents related to the products that you have purchased in the past have been gathered in the Document Library for your convenience.

Visit the Document Library

Difficulty Finding Your Product Or Lot/Batch Number?

Product numbers are combined with Pack Sizes/Quantity when displayed on the website (example: T1503-25G). Please make sure you enter ONLY the product number in the Product Number field (example: T1503).

Example:

T1503
Product Number
-
25G
Pack Size/Quantity

Additional examples:

705578-5MG-PW

PL860-CGA/SHF-1EA

MMYOMAG-74K-13

1000309185

enter as 1.000309185)

Having trouble? Feel free to contact Technical Service for assistance.

Lot and Batch Numbers can be found on a product's label following the words 'Lot' or 'Batch'.

Aldrich Products

  • For a lot number such as TO09019TO, enter it as 09019TO (without the first two letters 'TO').

  • For a lot number with a filling-code such as 05427ES-021, enter it as 05427ES (without the filling-code '-021').

  • For a lot number with a filling-code such as STBB0728K9, enter it as STBB0728 without the filling-code 'K9'.

Not Finding What You Are Looking For?

In some cases, a COA may not be available online. If your search was unable to find the COA you can request one.

Request COA

Customers Also Viewed

Slide 1 of 10

1 of 10

Articles

Infliximab and Adalimumab monoclonal antibodies (mAbs) are used widely to treat rheumatoid arthritis, psoriatic arthritis, and many autoimmune diseases by binding to tumor necrosis factor-alpha (TNFα) to reduce the inflammatory response.

Protocols

An optimized LC-MS/MS based workflow for low artifact tryptic digestion and peptide mapping of monoclonal antibody, adalimumab (Humira) using filter assisted sample preparation (FASP).

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service