추천 제품
생물학적 소스
rabbit
Quality Level
항체 형태
purified immunoglobulin
항체 생산 유형
primary antibodies
클론
polyclonal
종 반응성
mouse, human, rat
제조업체/상표
Upstate®
기술
ChIP: suitable
electrophoretic mobility shift assay: suitable
immunocytochemistry: suitable
immunoprecipitation (IP): suitable
western blot: suitable
동형
IgG
NCBI 수납 번호
UniProt 수납 번호
배송 상태
wet ice
타겟 번역 후 변형
unmodified
유전자 정보
human ... STAT3(6774)
mouse ... Stat3(20848)
일반 설명
STAT proteins (Signal Transduction and Activators of Transcription) are latent cytoplasmic transcription factors that have the dual function of signal transduction and activation of transcription. STATs are activated by tyrosine phosphorylation in response to different ligands, after which they translocate to the cell nucleus. The N-terminal region is highly homologous among the STAT proteins and surrounds a completely conserved arginine residue. STATs are a part of the JAK-STAT signaling pathway – a major pathway of the immune system. All cytokines transduce critical signals through this pathway. STAT3 has been shown to be activated by IFN alpha but not IFN beta. The transcription factors associated with STAT3 are cJun and cyclic AMP responsive enhancer binding protein (CREB). Deletion of the STAT3 gene in knock out mice was lethal at the early embryonic stage.
특이성
Recognizes STAT3, Mr 92 kDa. Additional unknown bands may be detected.
면역원
Bacterially expressed GST fusion protein corresponding to a.a. 688-722 of human STAT 3 (RPESQEHPEADPGSAAPYLKTKFICVTPTTCSNTI). The immunizing sequence is identical in mouse and rat STAT3. The first 28 amino acids are identical to mouse STAT3B.
Epitope: a.a. 688-722
애플리케이션
Anti-STAT3 Antibody is a Rabbit Polyclonal Antibody for detection of STAT3 also known as Acute-phase response factor or DNA-binding protein APRF & has been validated in ChIP, EMSA, ICC, IP & WB.
Immunoprecipitation:
4 μg of a previous lot immunoprecipitated STAT3 from 500 μg of EGF-stimulated A431 RIPA lysate.
Gel Shift Assay:
An independent laboratory has reported that this antibody supershifts.
Immunocytochemistry:
10 μg/mL of a previous lot of this antibody showed positive immunostaining for STAT3 in A431 cells fixed with 95% ethanol, 5% acetic acid.
4 μg of a previous lot immunoprecipitated STAT3 from 500 μg of EGF-stimulated A431 RIPA lysate.
Gel Shift Assay:
An independent laboratory has reported that this antibody supershifts.
Immunocytochemistry:
10 μg/mL of a previous lot of this antibody showed positive immunostaining for STAT3 in A431 cells fixed with 95% ethanol, 5% acetic acid.
Research Category
Epigenetics & Nuclear Function
Epigenetics & Nuclear Function
Research Sub Category
Transcription Factors
Transcription Factors
품질
Routinely evaluated by western blot on RIPA lysates from EGF stimulated human A431 cells, mouse WEHI or rat L6.
Western Blot Analysis:
0.5-2 μg/mL of this lot detected STAT3 in RIPA lysates from EGF stimulated human A431 cells and previously from mouse WEHI and rat L6.
Western Blot Analysis:
0.5-2 μg/mL of this lot detected STAT3 in RIPA lysates from EGF stimulated human A431 cells and previously from mouse WEHI and rat L6.
표적 설명
92 kDa
결합
Replaces: 04-1014
물리적 형태
Format: Purified
Protein A purified
Protein A purified rabbit IgG in 200 L of 0.1 M Tris-glycine, pH 7.4, 0.15 M NaCl, 0.05% sodium azide. Frozen at -20°C.
저장 및 안정성
Stable for 1 year at -20°C from date of receipt.
Handling Recommendations: Upon first thaw, and prior to removing the cap, centrifuge the vial and gently mix the solution. Aliquot into microcentrifuge tubes and store at -20°C. Avoid repeated freeze/thaw cycles, which may damage IgG and affect product performance.
Handling Recommendations: Upon first thaw, and prior to removing the cap, centrifuge the vial and gently mix the solution. Aliquot into microcentrifuge tubes and store at -20°C. Avoid repeated freeze/thaw cycles, which may damage IgG and affect product performance.
분석 메모
Control
Positive Antigen Control: Catalog #12-302, EGF-stimulated A431 cell lysate. Add 2.5µL of 2-mercaptoethanol/100µL of lysate and boil for 5 minutes to reduce the preparation. Load 20µg of reduced lysate per lane for minigels.
Positive Antigen Control: Catalog #12-302, EGF-stimulated A431 cell lysate. Add 2.5µL of 2-mercaptoethanol/100µL of lysate and boil for 5 minutes to reduce the preparation. Load 20µg of reduced lysate per lane for minigels.
기타 정보
Concentration: Please refer to the Certificate of Analysis for the lot-specific concentration.
법적 정보
UPSTATE is a registered trademark of Merck KGaA, Darmstadt, Germany
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
12 - Non Combustible Liquids
WGK
WGK 1
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
시험 성적서(COA)
제품의 로트/배치 번호를 입력하여 시험 성적서(COA)을 검색하십시오. 로트 및 배치 번호는 제품 라벨에 있는 ‘로트’ 또는 ‘배치’라는 용어 뒤에서 찾을 수 있습니다.
Differentiation of oligodendroglial progenitors derived from cortical multipotent cells requires extrinsic signals including activation of gp130/LIFbeta receptors
The Journal of Neuroscience, 18, 9800-9811 (1998)
Glutamine Deprivation Causes Hydrogen Peroxide-induced Interleukin-8 Expression via Jak1/Stat3 Activation in Gastric Epithelial AGS Cells.
Journal of cancer prevention null
The box-1 region of the leukemia inhibitory factor receptor alpha-chain cytoplasmic domain is sufficient for hemopoietic cell proliferation and differentiation
The Journal of Biological Chemistry, 273, 34370-34383 (1998)
PloS one, 10(3), e0119664-e0119664 (2015-03-18)
New evidence shows that high density lipoproteins (HDL) have protective effects beyond their role in reverse cholesterol transport. Reconstituted HDL (rHDL) offer an attractive means of clinically exploiting these novel effects including cardioprotection against ischemia reperfusion injury (IRI). However, basic
The Journal of biological chemistry, 274(14), 9729-9737 (1999-03-27)
Cell type-specific responses to the leukemia inhibitory factor (LIF)/interleukin 6 cytokine family are mediated by dimerization of the LIF receptor alpha-chain (LIFRalpha) with the signal transducer gp130 or of two gp130 molecules followed by activation of the JAK/STAT and Ras/mitogen-activated
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.