추천 제품
생물학적 소스
mouse
Quality Level
결합
unconjugated
항체 형태
purified immunoglobulin
항체 생산 유형
primary antibodies
클론
CL0371, monoclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
양식
buffered aqueous glycerol solution
종 반응성
human
향상된 검증
orthogonal RNAseq
RNAi knockdown
Learn more about Antibody Enhanced Validation
기술
immunoblotting: 1 μg/mL
immunofluorescence: 2-10 μg/mL
immunohistochemistry: 1:50- 1:200
동형
IgG1
Ensembl | 인체 수납 번호
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... WWTR1(25937)
일반 설명
WWTR1 (WW domain containing transcription regulator 1) is also known as TAZ (transcriptional co-activator with PDZ-binding motif). It is a transcriptional coactivator with a N-terminal TEAD-binding motif and without a DNA-binding motif. TAZ is a 14-3-3 binding protein that is expressed at high level in thyroid, kidney, heart, placenta and lung. It is present in cytoplasm and nucleus. The WWTR1 gene is located on human chromosome 3q25.1.
면역원
Recombinant protein corresponding to WW domain containing transcription regulator 1.
Sequence
MNPKPSSWRKKILPESFFKEPDSGSHSRQSSTDSSGGHPGPRLAGGAQHVRSHSSPASLQLGTGAGAAGSPAQQHAHLRQQSYDVTDELPLPPGWEMTFTATGQRYFLNHIEKITTWQDPRKAMNQPLNHMNLHPAVSST
Epitope
Binds to an epitope located within the peptide sequence SSWRKKILPESFFKE as determined by overlapping synthetic peptides.
Sequence
MNPKPSSWRKKILPESFFKEPDSGSHSRQSSTDSSGGHPGPRLAGGAQHVRSHSSPASLQLGTGAGAAGSPAQQHAHLRQQSYDVTDELPLPPGWEMTFTATGQRYFLNHIEKITTWQDPRKAMNQPLNHMNLHPAVSST
Epitope
Binds to an epitope located within the peptide sequence SSWRKKILPESFFKE as determined by overlapping synthetic peptides.
애플리케이션
All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
생화학적/생리학적 작용
WWTR1(WW domain containing transcription regulator 1)/TAZ (transcriptional co-activator with PDZ-binding motif) stimulates the multiplication of glioma cell and represses the apoptosis of glioma cells. TEADs are important interacting transcription factors of TAZ, which serve as effectors to promote cell proliferation, migration and epithelial-mesenchymal transition. TAZ participates in mesenchymal stem cell differentiation. It plays a vital role in mechanotransduction. Overexpression of TAZ leads to increased cell proliferation, epithelial-mesenchymal transition (EMT), cell migration and transformation.
특징 및 장점
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
결합
Corresponding Antigen APREST70841
물리적 형태
Phospate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
법적 정보
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 1
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
가장 최신 버전 중 하나를 선택하세요:
Antonio Cigliano et al.
Journal of experimental & clinical cancer research : CR, 41(1), 192-192 (2022-06-03)
Intrahepatic cholangiocarcinoma (iCCA) is a highly aggressive primary liver tumor with increasing incidence worldwide, dismal prognosis, and few therapeutic options. Mounting evidence underlines the role of the Hippo pathway in this disease; however, the molecular mechanisms whereby the Hippo cascade
The role of transcriptional coactivator TAZ in gliomas.
Li W, et al.
Oncotarget, 7(50), 82686?82699-82686?82699 (2016)
WWTR1 (WW domain containing transcription regulator 1).
Zhao Y and Yang X
Atlas of Genetics and Cytogenetics in Oncology and Haematology, 18(11), 849-849 (2014)
Shu Zhang et al.
The American journal of pathology, 190(7), 1397-1413 (2020-04-14)
Hepatoblastoma (HB) is the most common pediatric liver tumor. Though Wnt/β-catenin and Hippo cascades are implicated in HB development, studies on crosstalk between β-catenin and Hippo downstream effector transcriptional coactivator with PDZ-binding motif (TAZ) in HB are lacking. Expression levels
Patricia García et al.
Cancers, 12(4) (2020-03-29)
Gallbladder cancer is an aggressive disease with late diagnosis and no efficacious treatment. The Hippo-Yes-associated protein 1 (YAP1) signaling pathway has emerged as a target for the development of new therapeutic interventions in cancers. However, the role of the Hippo-targeted
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.