AV32533
Anti-SPDEF (AB1) antibody produced in rabbit
affinity isolated antibody
동의어(들):
Spdef Antibody, Spdef Antibody - Anti-SPDEF (AB1) antibody produced in rabbit, Anti-PDEF, Anti-RP11-375E1__A.3, Anti-SAM pointed domain containing ets transcription factor, Anti-bA375E1.3
로그인조직 및 계약 가격 보기
모든 사진(2)
About This Item
UNSPSC 코드:
12352203
NACRES:
NA.41
추천 제품
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
항체 생산 유형
primary antibodies
클론
polyclonal
양식
buffered aqueous solution
분자량
37 kDa
종 반응성
bovine, rabbit, human, dog, guinea pig
농도
0.5 mg - 1 mg/mL
기술
western blot: suitable
NCBI 수납 번호
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... SPDEF(25803)
일반 설명
Rabbit polyclonal anti-SPDEF (AB1) antibody reacts with human, mouse, rat, bovine, pig, and canine SAM pointed domain containing ets transcription factors.
SAM pointed domain containing ets transcription factor (SPDEF, PDEF) is involved in the regulation of terminal differentiation of goblet/Paneth progenitor cells into intestinal Paneth and goblet cells. SPDEF plays a critical role in regulating a transcriptional network mediating IL-13-induced MUC5AC synthesis dependent on STAT6.
SPDEF suppresses the metastasis of prostate cancer and modulates goblet cell hyperplasia in airway epithelial cells.
Rabbit Anti-SPDEF (AB1) antibody recognizes human, mouse, rat, bovine, pig, and canine SPDEF.
Rabbit Anti-SPDEF (AB1) antibody recognizes human, mouse, rat, bovine, pig, and canine SPDEF.
면역원
Synthetic peptide directed towards the middle region of human SPDEF
애플리케이션
Rabbit Anti-SPDEF (AB1) antibody can be used for western blot applications at a concentration of 1μg/ml.
Rabbit polyclonal anti-SPDEF (AB1) antibody is used to tag SAM pointed domain containing ets transcription factor for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of SAM pointed domain containing ets transcription factor in the differentiation of Paneth and goblet cells and mucin production.
생화학적/생리학적 작용
PDEF is an ETS transcription factor expressed in prostate epithelial cells. It acts as an androgen-independent transactivator of PSA expression.PDEF is an ETS transcription factor expressed in prostate epithelial cells. It acts as an androgen-independent transactivator of PSA (MIM 176820) expression.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
서열
Synthetic peptide located within the following region: ELCAMSEEQFRQRSPLGGDVLHAHLDIWKSAAWMKERTSPGAIHYCASTS
물리적 형태
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
가장 최신 버전 중 하나를 선택하세요:
Kwon-Sik Park et al.
The Journal of clinical investigation, 117(4), 978-988 (2007-03-10)
Goblet cell hyperplasia and mucous hypersecretion contribute to the pathogenesis of chronic pulmonary diseases including cystic fibrosis, asthma, and chronic obstructive pulmonary disease. In the present work, mouse SAM pointed domain-containing ETS transcription factor (SPDEF) mRNA and protein were detected
Joshua J Steffan et al.
The Journal of biological chemistry, 287(35), 29968-29978 (2012-07-05)
Emerging evidence suggests that the SAM pointed domain containing ETS transcription factor (SPDEF) plays a significant role in tumorigenesis in prostate, breast, colon, and ovarian cancer. However, there are no in vivo studies with respect to the role of SPDEF
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.