AV32762

Anti-PIAS3 antibody produced in rabbit

IgG fraction of antiserum

• 동의어(들): Anti-Protein inhibitor of activated STAT, 3
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: IgG fraction of antiserum
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 형태: buffered aqueous solution
• 분자량: 67 kDa
• 종 반응성: horse, human, bovine, rat, dog, pig
• 농도: 0.5 mg - 1 mg/mL
• 기술: immunohistochemistry: suitable; western blot: suitable
• NCBI 수납 번호: NP_006090
• UniProt 수납 번호: Q9Y6X2
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... PIAS3(10401)

설명

일반 설명

PIAS3 is a transcription factor that facilitates protein SUMOylation. It inhibits STAT3-mediated signaling and studies have reported that its overexpression can induce apoptosis in prostate cancer cells. PIAS3 can also function as a biomarker for human cancer.
Rabbit Anti-PIAS3 antibody recognizes human, rat, canine, mouse, and bovine PIAS3.

면역원

Synthetic peptide directed towards the C terminal region of human PIAS3

애플리케이션

Rabbit Anti-PIAS3 antibody can be used for western blot (1.0-2.0 μg/ml) and IHC (4-8 μg/ml) applications.

생화학적/생리학적 작용

PIAS3 is a member of the protein inhibitor of activated STAT (PIAS) family. It also activates TGF-beta/SMAD transcriptional responses.

서열

Synthetic peptide located within the following region: TSLDEQDALGHFFQYRGTPSHFLGPLAPTLGSSHCSATPAPPPGRVSSIV

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable