AV34727

Anti-KEAP1 (AB1) antibody produced in rabbit

affinity isolated antibody

• 동의어(들): Anti-Kelch-like ECH-associated protein 1
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 형태: buffered aqueous solution
• 분자량: 70 kDa
• 종 반응성: human, rabbit, dog, rat, bovine, horse, pig, mouse
• 농도: 0.5 mg - 1 mg/mL
• 기술: immunohistochemistry: suitable; western blot: suitable
• NCBI 수납 번호: NP_036421
• UniProt 수납 번호: Q14145
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... KEAP1(9817)

설명

일반 설명

KEAP1 codes for a KELCH-1 like domain-containing protein that interacts with NF-E2-related factor 2. KEPAP1 has been implicated in cell signaling pathways that regulate responses to environmental and oxidative stresses.
Rabbit Anti-KEAP1 antibody recognizes pig, zebrafish, canine, bovine, human, mouse, and rat KEAP1.

면역원

Synthetic peptide directed towards the N terminal region of human KEAP1

애플리케이션

Rabbit Anti-KEAP1 antibody is suitable for western blot (0.5 μg/ml) applications.

생화학적/생리학적 작용

KEAP1 contains KELCH-1 like domains, as well as a BTB/POZ domain. Kelch-like ECH-associated protein 1 interacts with NF-E2-related factor 2 in a redox-sensitive manner and the dissociation of the proteins in the cytoplasm is followed by transportation of NF-E2-related factor 2 to the nucleus. This interaction results in the expression of the catalytic subunit of gamma-glutamylcysteine synthetase.Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests.This gene encodes a protein containing KELCH-1 like domains, as well as a BTB/POZ domain. Kelch-like ECH-associated protein 1 interacts with NF-E2-related factor 2 in a redox-sensitive manner and the dissociation of the proteins in the cytoplasm is followed by transportation of NF-E2-related factor 2 to the nucleus. This interaction results in the expression of the catalytic subunit of gamma-glutamylcysteine synthetase. Two alternatively spliced transcript variants encoding the same isoform have been found for this gene.

서열

Synthetic peptide located within the following region: SQCPEGAGDAVMYASTECKAEVTPSQHGNRTFSYTLEDHTKQAFGIMNEL

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 2
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable