콘텐츠로 건너뛰기
Merck
모든 사진(1)

주요 문서

AV36498

Sigma-Aldrich

Anti-DDX54 antibody produced in rabbit

affinity isolated antibody

동의어(들):

Anti-DEAD (Asp-Glu-Ala-Asp) box polypeptide 54, Anti-DP97, Anti-MGC2835

로그인조직 및 계약 가격 보기


About This Item

UNSPSC 코드:
12352203
NACRES:
NA.41

생물학적 소스

rabbit

Quality Level

결합

unconjugated

항체 형태

affinity isolated antibody

항체 생산 유형

primary antibodies

클론

polyclonal

양식

buffered aqueous solution

분자량

97 kDa

종 반응성

bovine, dog, human

농도

0.5 mg - 1 mg/mL

기술

western blot: suitable

NCBI 수납 번호

UniProt 수납 번호

배송 상태

wet ice

저장 온도

−20°C

타겟 번역 후 변형

unmodified

유전자 정보

human ... DDX54(79039)

면역원

Synthetic peptide directed towards the C terminal region of human DDX54

생화학적/생리학적 작용

DEAD (Asp-Glu-Ala-Asp) box helicase 54 (DDX54) is a member of putative ATP-dependent RNA helicases called the DEAD box proteins. It is involved in regulation of RNA secondary structure during translation initiation, nuclear and mitochondrial splicing and ribosome and spliceosome assembly. DDX54 binds to myelin basic protein (MBP) in the brain and is critical for myelination in the central nervous system. Also known as DP97, this protein acts as a co-regulator of the constitutive androstane receptor.

서열

Synthetic peptide located within the following region: GPNRGAKRRREEARQRDQEFYIPYRPKDFDSERGLSISGEGGAFEQQAAG

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

10 - Combustible liquids

WGK

WGK 2

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable


가장 최신 버전 중 하나를 선택하세요:

시험 성적서(COA)

Lot/Batch Number

적합한 버전을 찾을 수 없으신가요?

특정 버전이 필요한 경우 로트 번호나 배치 번호로 특정 인증서를 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

Rui Zhan et al.
Journal of neuroscience research, 91(3), 335-348 (2012-12-15)
We recently reported that a new monoclonal antibody, 4F2, which labels oligodendroglial lineage cells, recognizes a DEAD-box RNA helicase Ddx54 and that Ddx54 binds to myelin basic protein (MBP) in brain and cultured oligodendrocytes. To elucidate the biological function of
Yuichiro Kanno et al.
Biochemical and biophysical research communications, 426(1), 38-42 (2012-08-23)
The constitutive androstane receptor (CAR) plays a key role in the expression of xenobiotic/steroid and drug metabolizing enzymes and their transporters. In this study, we demonstrated that DP97, a member of the DEAD box DNA/RNA helicase protein family, is a
Frances V Fuller-Pace
Nucleic acids research, 34(15), 4206-4215 (2006-08-29)
The DExD/H box family of proteins includes a large number of proteins that play important roles in RNA metabolism. Members of this family have been shown to act as RNA helicases or unwindases, using the energy from ATP hydrolysis to

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.