추천 제품
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
IgG fraction of antiserum
항체 생산 유형
primary antibodies
클론
polyclonal
양식
buffered aqueous solution
분자량
25 kDa
종 반응성
dog, horse, human
농도
0.5 mg - 1 mg/mL
기술
western blot: suitable
NCBI 수납 번호
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... GJB2(2706)
면역원
Synthetic peptide directed towards the N terminal region of human GJB2
생화학적/생리학적 작용
GJB2 also known as connexin 26 is a gap junction protein that belongs to the connexin family. It is a component of the gap junctions between cells that facilitate the diffusion of low molecular weight materials and ions from cell to cell. Mutations in GJB2 gene is one of the major factors the causes hereditary hearing loss and lethal form of Keratitis-Ichthyosis-Deafness Syndrome.
서열
Synthetic peptide located within the following region: STPALLVAMHVAYRRHEKKRKFIKGEIKSEFKDIEEIKTQKVRIEGSLWW
물리적 형태
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 1
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
가장 최신 버전 중 하나를 선택하세요:
Lethal form of keratitis-ichthyosis-deafness syndrome caused by the GJB2 mutation p.Ser17Phe.
Juliette Mazereeuw-Hautier et al.
Acta dermato-venereologica, 94(5), 591-592 (2014-02-18)
Linkage study and exome sequencing identify a BDP1 mutation associated with hereditary hearing loss.
Giorgia Girotto et al.
PloS one, 8(12), e80323-e80323 (2013-12-07)
Nonsyndromic Hereditary Hearing Loss is a common disorder accounting for at least 60% of prelingual deafness. GJB2 gene mutations, GJB6 deletion, and the A1555G mitochondrial mutation play a major role worldwide in causing deafness, but there is a high degree
Charles K Abrams et al.
Biochimica et biophysica acta, 1818(8), 2030-2047 (2011-08-30)
CNS glia and neurons express connexins, the proteins that form gap junctions in vertebrates. We review the connexins expressed by oligodendrocytes and astrocytes, and discuss their proposed physiologic roles. Of the 21 members of the human connexin family, mutations in
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.