AV37905

Anti-MyBBP1A antibody produced in rabbit

affinity isolated antibody

• 동의어(들): Anti-AL024407, Anti-AU019902, Anti-MyB binding protein (P160) 1a, Anti-P160, Anti-p160MBP, Anti-p67MBP
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 형태: buffered aqueous solution
• 분자량: 152 kDa
• 종 반응성: mouse, human
• 농도: 0.5 mg - 1 mg/mL
• 기술: western blot: suitable
• NCBI 수납 번호: NP_058056
• UniProt 수납 번호: Q7TPV4
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: mouse ... Mybbp1a(18432)

설명

일반 설명

MyB binding protein (P160) 1a (MyBBP1A), a c-myb proto-oncogene product (c-Myb)-interacting protein, is post-translationally processed to 67 kDa fragment (p67MBP). MyBBP1A is primarily expressed in the nucleoli. MyBBP1A which is associated with RNA Polymerase 1 complex and ribosome biogenesis machinery regulates rRNA metabolism and is believed to connect the process of ribosome biogenesis and Myb-dependent transcription to regulate/coordinate cell cycle progression and proliferation.

특이성

Anti-MyBBP1A polyclonal antibody reacts with human, rat, and mouse MyB binding protein (P160) 1a proteins.

면역원

Synthetic peptide directed towards the C terminal region of mouse Mybbp1a

애플리케이션

Anti-MyBBP1A polyclonal antibody is used to tag MyB binding protein (P160) 1a protein for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of MyB binding protein (P160) 1a in the coordination and regulation of rRNA biosynthesis and ribosome biogenesis.

생화학적/생리학적 작용

Mybbp1a may activate or repress transcription via interactions with sequence specific DNA-binding proteins. Repression may be mediated at least in part by histone deacetylase activity.

서열

Synthetic peptide located within the following region: HSSGSNRLYDLYWQAMRMLGVQRPKSEKKNAKDIPSDTQSPVSTKRKKKG

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 2
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable