추천 제품
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
IgG fraction of antiserum
항체 생산 유형
primary antibodies
클론
polyclonal
형태
buffered aqueous solution
분자량
63 kDa
종 반응성
sheep, mouse, dog, horse, rat, guinea pig, bovine, human, goat, rabbit
농도
0.5 mg - 1 mg/mL
기술
immunohistochemistry: suitable
western blot: suitable
NCBI 수납 번호
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... RORA(6095)
면역원
Synthetic peptide directed towards the middle region of human RORA
애플리케이션
Anti-RORA (AB3) antibody produced in rabbit is suitable for western blotting at a concentration of 1.25μg/ml and for immunohistochemistry of paraffin-embedded tissue sections at a concentration of 4-8μg/ml.
생화학적/생리학적 작용
Retinoic acid related orphan receptor A (RORA), a member of the retinoid-related orphan family of nuclear receptors, is a ligand-dependent transcription factor. RORA is widely expressed and enhances p53-dependent apoptosis. RORA is important for the development of the cerebellum and it is required for the maturation of photoreceptors in the retina.
서열
Synthetic peptide located within the following region: GHTPEGSKADSAVSSFYLDIQPSPDQSGLDINGIKPEPICDYTPASGFFP
물리적 형태
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
시험 성적서(COA)
제품의 로트/배치 번호를 입력하여 시험 성적서(COA)을 검색하십시오. 로트 및 배치 번호는 제품 라벨에 있는 ‘로트’ 또는 ‘배치’라는 용어 뒤에서 찾을 수 있습니다.
Thanh-Tam Tran et al.
Experimental & molecular medicine, 55(12), 2553-2563 (2023-12-01)
Oral diseases exhibit a significant association with metabolic syndrome, including dyslipidemia. However, direct evidence supporting this relationship is lacking, and the involvement of cholesterol metabolism in the pathogenesis of periodontitis (PD) has yet to be determined. In this study, we
David A Gold et al.
Brain research, 1140, 19-25 (2006-01-24)
The staggerer mutation was first identified at the Jackson Laboratory in 1955. In the ensuing half-century, studies of staggerer mice have provided new insights into developmental neurobiology, gene regulatory networks, and circadian behavior. Recent work has expanded the role of
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.